(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE59

ACCPU_3.PE59         Location/Qualifiers
FT   CDS_pept        64441..64683
FT                   /locus_tag="CAP2UW1_4630"
FT                   /gene_family="HOG000117478" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091564"
FT                   /db_xref="GeneID:8401999"
FT                   /translation="MKPYHLPSGLGGGLDFLICADWTPDQALAVVELLEDLRDRIWAHY
FT                   ELALFDLLREERGGPGEPLPGDHSTAEDWPDEPPF"
FT                   /protein_id="YP_003165207.1"
     ATGAAGCCTT ATCACCTGCC TTCCGGGCTG GGCGGTGGCC TCGATTTCCT GATCTGTGCC        60
     GACTGGACGC CGGATCAGGC GCTGGCCGTC GTCGAACTGC TCGAAGATCT GCGTGACCGC       120
     ATCTGGGCCC ACTACGAGTT GGCGCTCTTC GACTTGCTGC GCGAGGAACG CGGCGGTCCG       180
     GGCGAGCCAC TTCCTGGCGA CCACAGCACA GCCGAAGACT GGCCTGACGA ACCGCCGTTC       240
     TAA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page