(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE6

ACCPU_3.PE6          Location/Qualifiers
FT   CDS_pept        3143..7102
FT                   /locus_tag="CAP2UW1_4573"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091511"
FT                   /db_xref="GeneID:8401946"
FT                   /translation="MPHDKGLPQTGDSQEIGQDAYDCLRAKRPKGWQLTELGGVNDFGF
FT                   DLQVQISVKQQVVHPFRLQLKGTRSPLRSADGSFLSINLSTTTLRYFDNTDEPVLLVLC
FT                   DLSVDPEEPRECPLHYVWIREELDRIQIASVSLEQKEAAIRVPTANVLDRTTDLVDEVQ
FT                   KRHRLSRVGHALDTSVAGMDPSLGSEDRVVMVEAITRNIGTRSIVFAQALAEPATDVWI
FT                   NPPRGSLAWLLTEAKSAVASGEVDKCADLLRQASERFEPASAMEKAEYWHLTGRLRLVR
FT                   GDDEGASRAFKSAAETQPQAKYWAAWAESEMRRGFRNDQGQDYSDVLEALPADADPALL
FT                   GVKARLLAASRKHAEAIALLDTFEGTESLAARAVVETMFSNPDQALQACIDGIDLEEKR
FT                   ESTRLLFLILRARARFNIALRSARVEESSGEHSEDEVLPPSGPIGVDAAALREAWADIE
FT                   EAVSAMEEIRWVSNAEFVIDLWIATASMLGKQEQILARVLAAARQRPQQAELQSAAETL
FT                   AAQCGDFQAALEANSRLPDGNMKVLRRVSFLHELGKHRDCVELMAANIDTVGRSHQLFG
FT                   HVLVLAALSADVMARDPLVEAWLDILRSGDAESQAHAATLDHLLARRRNQLQSREALTD
FT                   LARVDEQLGHPKPTTLLLFEELDPGSETQAEQFLAVATRLRSMIRLSPMIAVRIGVALA
FT                   TGKRWSDLLALCEEASREFDVTGRIKAFQALALDQLGRSDEARSILESMLEGGIEDGLA
FT                   LNTYVNIMVRWGFTEKAKAAAELILERAQSKERRVECVRMLFNLEQHANPTSPRLVDLA
FT                   FRMGALASSDDEVEEGVFLCMVIAATSFETAVLSDARKEEFQARTNAFFERFPQSKILR
FT                   RVELPAEAGAEEMLRSMKSAIGVSEEREQQRARLEAQLQSGELPLPFAWRPRFALGSVQ
FT                   DVAHLWDLAKRSTVDEKKFHLNMIGEQWEQRPADSFRSRTPLFDLLTLFVLEDLELLDK
FT                   VFDFFPKVAISQETLGELMKMSQAFSGSIFRQRCIDVQDRLRPRLAQILQPHGAPSDDE
FT                   LHLPSSSRELKSLARTGNYVVYSDDAMLRMWIFEDKFAADGMCTLDLLCGLEETGLLTT
FT                   EEVATKLAQLCDWHVGIQIQLRHQLALIPETVRLAPRVLEAAAMLRGIAPFMSLARGMW
FT                   GPGTDFMGVLNHVGAVVRLLVQDPAVPDIAIGAFVAVWIDHATARADMPLPALQLAAHI
FT                   AVYAVAAGKLPIQAARRLWNVYFGVVEAVHGAPDSKAYGLALARVAQEAGALDKRMTKE
FT                   RVTPQTTIGERLMMGLDLISNAWEAFSAAYIPARK"
FT                   /protein_id="YP_003165154.1"
     ATGCCACACG ACAAAGGATT GCCGCAGACC GGCGACTCGC AAGAGATCGG ACAAGACGCC        60
     TACGACTGTC TGCGCGCAAA GCGGCCCAAG GGCTGGCAGC TCACGGAGCT TGGTGGCGTC       120
     AACGACTTCG GCTTTGATCT ACAAGTGCAA ATCAGCGTGA AGCAGCAGGT CGTCCACCCC       180
     TTCCGCCTCC AGCTCAAGGG CACGCGCTCG CCGCTGCGCA GTGCAGACGG GAGCTTCCTC       240
     TCCATCAACC TTTCTACCAC GACGCTTCGC TACTTCGACA ACACGGACGA GCCCGTCCTT       300
     CTGGTTCTAT GCGACCTGAG CGTTGATCCA GAGGAGCCCC GCGAGTGCCC GCTTCACTAC       360
     GTCTGGATTC GCGAGGAGCT TGACCGTATT CAGATCGCTT CCGTCTCCTT GGAGCAGAAG       420
     GAGGCCGCGA TTCGCGTGCC GACGGCCAAC GTCTTGGATC GCACGACGGA TCTGGTCGAC       480
     GAGGTCCAGA AGCGACATCG CCTTTCTCGA GTGGGGCATG CGCTGGACAC CAGCGTAGCC       540
     GGGATGGACC CGTCGCTCGG CTCGGAGGAT CGAGTCGTCA TGGTGGAGGC GATCACCAGA       600
     AACATTGGCA CCCGCAGCAT CGTCTTCGCC CAAGCCCTGG CGGAGCCCGC CACCGACGTT       660
     TGGATCAACC CACCGCGCGG CAGCTTGGCC TGGTTGCTCA CGGAAGCGAA GTCCGCCGTG       720
     GCCTCAGGCG AGGTGGACAA GTGCGCGGAC CTGCTCCGTC AGGCCTCAGA GCGTTTTGAG       780
     CCTGCGTCGG CGATGGAGAA AGCGGAATAC TGGCACCTGA CCGGCCGGCT CCGCCTCGTC       840
     CGAGGCGACG ACGAAGGCGC GTCCCGCGCG TTCAAAAGTG CCGCCGAGAC GCAACCGCAG       900
     GCCAAATACT GGGCAGCCTG GGCAGAGAGC GAGATGCGCC GGGGGTTCAG AAACGACCAA       960
     GGCCAGGACT ATTCGGACGT GCTCGAGGCC CTGCCAGCGG ACGCGGACCC GGCGCTGCTC      1020
     GGCGTCAAGG CCCGCCTCCT CGCCGCCAGC CGCAAGCACG CCGAAGCCAT CGCGCTTCTT      1080
     GACACTTTCG AAGGCACTGA GAGCCTCGCG GCGCGGGCAG TGGTCGAGAC CATGTTCTCG      1140
     AATCCCGACC AGGCGCTGCA AGCGTGCATC GACGGCATCG ACTTGGAAGA AAAACGGGAG      1200
     TCGACAAGGC TGTTGTTCCT GATCTTGCGG GCGCGAGCGC GGTTCAACAT CGCGTTGAGA      1260
     AGCGCGCGTG TCGAGGAATC GAGCGGCGAG CACTCGGAGG ACGAGGTCCT TCCTCCTTCG      1320
     GGCCCCATCG GGGTCGACGC GGCCGCGCTA CGCGAAGCGT GGGCCGACAT CGAAGAGGCC      1380
     GTCTCCGCCA TGGAGGAGAT CAGATGGGTG TCGAACGCCG AGTTCGTGAT CGACCTCTGG      1440
     ATCGCCACCG CGAGCATGCT TGGCAAGCAG GAGCAGATTC TCGCCCGGGT GTTGGCCGCA      1500
     GCGCGGCAGC GGCCGCAGCA AGCCGAGCTC CAGTCGGCAG CAGAGACCCT CGCGGCCCAG      1560
     TGCGGCGATT TCCAGGCGGC CTTGGAAGCG AACAGCCGGC TGCCCGACGG CAACATGAAA      1620
     GTCCTGCGCC GCGTCTCGTT TCTGCATGAG CTCGGCAAGC ACCGCGACTG CGTCGAACTG      1680
     ATGGCGGCAA ACATCGACAC AGTCGGTCGC TCACACCAGC TATTCGGACA CGTCTTGGTG      1740
     CTGGCGGCCC TGTCGGCCGA CGTGATGGCT AGGGATCCTC TGGTCGAGGC TTGGCTCGAC      1800
     ATCTTGCGCT CTGGAGATGC GGAAAGCCAA GCGCATGCCG CGACCTTGGA CCACTTGCTC      1860
     GCACGGCGCA GGAACCAGCT GCAAAGCCGC GAGGCTTTGA CTGATCTCGC CCGCGTCGAC      1920
     GAGCAGCTTG GGCACCCCAA ACCGACCACG TTGCTCCTAT TCGAAGAGCT GGACCCCGGT      1980
     TCCGAGACGC AGGCCGAGCA GTTTCTCGCC GTCGCGACGC GCTTGCGCTC GATGATTCGG      2040
     CTGTCCCCGA TGATCGCTGT GAGGATTGGG GTCGCCTTGG CCACCGGGAA GCGGTGGAGC      2100
     GATCTGCTCG CCTTGTGCGA GGAGGCCAGC CGAGAGTTTG ACGTCACGGG TCGGATCAAA      2160
     GCGTTCCAAG CGCTAGCGCT CGACCAGTTG GGCCGGTCCG ACGAGGCGAG GTCCATCCTG      2220
     GAGAGCATGC TCGAAGGCGG CATTGAGGAC GGGCTCGCTT TGAACACGTA CGTGAACATC      2280
     ATGGTTCGCT GGGGGTTCAC TGAGAAGGCC AAAGCGGCAG CTGAGTTGAT CTTGGAGCGC      2340
     GCACAGTCGA AGGAACGGCG CGTCGAGTGC GTCCGGATGC TGTTCAACCT TGAGCAGCAT      2400
     GCGAACCCCA CCAGCCCCCG GCTCGTCGAC CTAGCTTTTC GCATGGGAGC GCTCGCGTCC      2460
     AGCGACGACG AGGTGGAAGA AGGGGTGTTT CTTTGCATGG TCATCGCCGC AACAAGCTTC      2520
     GAGACGGCGG TGTTGAGCGA TGCGCGCAAG GAGGAGTTCC AAGCCCGCAC GAACGCCTTC      2580
     TTCGAACGGT TCCCCCAATC GAAGATTCTT CGCCGAGTCG AGCTCCCGGC TGAGGCTGGC      2640
     GCGGAGGAGA TGCTGCGCTC AATGAAGTCC GCCATTGGAG TATCGGAAGA GCGCGAGCAA      2700
     CAACGAGCGC GGCTCGAAGC TCAGCTTCAA AGCGGCGAGT TGCCATTGCC CTTCGCGTGG      2760
     CGTCCACGCT TCGCGCTTGG CAGTGTGCAG GACGTGGCAC ATCTCTGGGA TCTGGCGAAG      2820
     CGGTCAACGG TCGACGAGAA GAAGTTCCAC CTGAACATGA TCGGCGAGCA GTGGGAGCAG      2880
     CGGCCAGCCG ATTCCTTTCG TTCGAGGACA CCCCTGTTCG ATCTGCTCAC TCTGTTCGTG      2940
     CTCGAAGACC TCGAACTGCT CGACAAGGTC TTCGACTTCT TCCCCAAGGT CGCAATCTCC      3000
     CAGGAGACCT TGGGCGAGCT GATGAAAATG TCGCAGGCGT TCTCTGGAAG CATCTTCCGG      3060
     CAGCGGTGCA TCGATGTGCA GGATCGCCTC AGGCCACGCC TCGCGCAGAT CCTGCAGCCC      3120
     CACGGAGCGC CTTCGGACGA CGAACTGCAC CTGCCGAGCT CGTCGCGCGA ACTTAAAAGC      3180
     CTTGCCCGCA CTGGCAACTA CGTCGTCTAC TCCGACGACG CCATGCTGCG AATGTGGATA      3240
     TTTGAGGACA AGTTCGCCGC TGACGGAATG TGCACCTTGG ACCTGCTCTG CGGGTTGGAG      3300
     GAGACCGGTC TGCTGACCAC GGAAGAAGTG GCGACCAAAC TCGCGCAACT CTGCGACTGG      3360
     CACGTGGGCA TACAAATCCA GCTGAGGCAT CAGCTGGCTC TCATCCCGGA AACGGTTCGC      3420
     CTCGCGCCCC GCGTCTTGGA GGCCGCTGCG ATGCTTCGCG GTATCGCACC CTTCATGTCG      3480
     CTCGCCCGAG GCATGTGGGG GCCGGGCACG GACTTCATGG GCGTCCTCAA TCACGTCGGA      3540
     GCTGTCGTCC GACTATTGGT TCAGGACCCC GCCGTGCCGG ACATCGCCAT CGGCGCCTTT      3600
     GTCGCGGTAT GGATCGACCA CGCAACCGCG AGGGCCGACA TGCCACTTCC CGCGCTGCAG      3660
     CTGGCGGCGC ACATCGCCGT GTATGCCGTG GCGGCTGGAA AGCTGCCAAT CCAGGCGGCC      3720
     CGCCGGCTTT GGAACGTCTA CTTCGGCGTA GTCGAGGCGG TGCACGGTGC GCCGGACTCG      3780
     AAGGCTTACG GTCTCGCGCT CGCCCGAGTC GCGCAAGAAG CGGGCGCTTT GGACAAGAGG      3840
     ATGACCAAGG AACGCGTCAC TCCGCAAACG ACCATCGGCG AGCGGCTTAT GATGGGTCTC      3900
     GACTTGATTT CCAATGCGTG GGAGGCCTTC TCCGCCGCTT ACATCCCAGC GCGCAAATGA      3960
//

If you have problems or comments...

PBIL Back to PBIL home page