(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE61

ACCPU_3.PE61         Location/Qualifiers
FT   CDS_pept        complement(67668..68600)
FT                   /locus_tag="CAP2UW1_4632"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091566"
FT                   /db_xref="GeneID:8402001"
FT                   /translation="MTLPAHKTTDGAAAARYAAGLLGVATCAETTATTMAEDAGKVDVK
FT                   FSFRHIVATGKLITAHAQVKAGPSYRRDSSNTQFLTLRIDKATLQALSGTGMPGLVIWV
FT                   PPPPMDRLYWYATDPRRPLRTPAKVRRTQYLRPSLRYDLSRLYDYASWSRRYTKQTVAA
FT                   LSSAQVMPRAKEAYKALKAQQWHNPLVGPLQITRFAWRHITRRSKSVARRTMSLRILPY
FT                   LKAFLASPPDRYTSNFVGLKANGSITTETRYLMCWYRQALTVDGESHSLLVRIREEITY
FT                   PTEWAKRPLSDTEVQQVATLAAWWCKRDK"
FT                   /protein_id="YP_003165209.1"
     atgacccttc cagctcacaa gactacagac ggcgccgccg ctgcccgtta cgcagcaggc        60
     cttctcgggg ttgccacctg tgccgagact acggccacca cgatggccga ggatgccggc       120
     aaggtcgacg tgaagttctc gtttcgtcac atagtggcga cgggaaagct aatcaccgcc       180
     catgctcaag taaaggctgg gccgtcgtat cgccgagact catcgaatac gcagttttta       240
     acacttcgaa ttgacaaggc aacacttcaa gccctttcag ggactggcat gcccggtctg       300
     gttatttggg ttccgccgcc tcccatggac cggctctact ggtatgcaac cgaccctcga       360
     agaccactca ggacgcctgc aaaagttcga agaacgcaat acctacgtcc atcgcttcgc       420
     tacgaccttt cccggctgta cgactacgcc tcatggtcac gtcgctatac aaaacaaacc       480
     gtcgcagcgt tgtctagcgc acaggtaatg ccaagagcaa aggaagccta caaggcacta       540
     aaggcacagc agtggcacaa cccacttgtt gggcctcttc aaatcacccg atttgcttgg       600
     cgccacatta caagacggtc aaagtcggta gcgagacgca caatgtcatt gagaattctt       660
     ccctacctga aagcatttct tgctagccca cctgaccgct acaccagcaa cttcgtaggg       720
     ctaaaggcga atggctcgat aacaaccgaa acccgatacc tgatgtgttg gtaccgccaa       780
     gcactcacgg ttgacggaga gagtcactcg ctcttggtca gaatccgcga ggagatcact       840
     tacccaacag aatgggctaa acgaccgctt agcgacacgg aagttcagca ggtagcgaca       900
     ttggcggctt ggtggtgcaa gagggacaag tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page