(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE63

ACCPU_3.PE63         Location/Qualifiers
FT   CDS_pept        complement(69238..70026)
FT                   /locus_tag="CAP2UW1_4634"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091568"
FT                   /db_xref="GeneID:8402003"
FT                   /translation="MNPVPQLEPLLKQLRLSGILDSLDARNRQAIEAKLAYTDFLALLV
FT                   QDEIARRDQRQFAQRLRKAQVIGDKTLERFDYTHSPSVNHALIAELATCRFVTEHSSVL
FT                   IAGPTGTGKSHLVQSLCHCALRAGHEVLFISHTKLLAQLQAARATDTFERKLRQLARID
FT                   VLAIDDFGLRPMRSPQDEDFHDLIDARYERTTSLLTSNLHFDEWGAAFPNKLMGAATLD
FT                   RLRDGAYRIVLDGETRRKPRPMPESTSAARIPPATLQAAR"
FT                   /protein_id="YP_003165211.1"
     atgaatcccg tgcctcaact cgaacctctc ctcaagcaac tgcgcctgtc cggcatcctc        60
     gattcactcg acgccagaaa tcgccaggcc atcgaggcca aactggctta caccgatttc       120
     ctcgcgctcc tggtgcaaga cgaaatcgcc cgtcgcgatc agcgccagtt cgcccagcgc       180
     ctgcgcaagg cgcaggtgat cggtgacaag accctggaac gttttgatta cacccacagt       240
     ccgtcggtca atcatgccct gatcgccgaa ctggcgacct gccgattcgt caccgaacat       300
     tcatccgttc tgatcgccgg ccccaccggg accggcaagt cacatctcgt tcagtcgctc       360
     tgtcattgtg cgctgcgcgc cggccatgag gtgttgttca tttcgcacac caaactgctg       420
     gcgcagctcc aggctgcccg agccaccgac acgtttgagc gcaagctacg gcaactggcg       480
     cgcatcgatg tcctcgccat cgatgacttc ggtttgcgtc ccatgcgctc accgcaggat       540
     gaggatttcc acgatctcat cgacgcacgc tacgagcgga ccaccagctt gctcactagc       600
     aatcttcact tcgacgagtg gggtgcggca tttcccaaca agttgatggg ggcagcaacg       660
     cttgatcgct tgcgcgacgg ggcctatcgc atcgtcctcg acggggagac gcggcgcaag       720
     ccacggccga tgccggaatc gacctcggcc gcacgcatcc cgcctgcaac cctccaggct       780
     gcccgctag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page