(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE64

ACCPU_3.PE64         Location/Qualifiers
FT   CDS_pept        complement(70081..71619)
FT                   /locus_tag="CAP2UW1_4635"
FT                   /gene_family="HOG000023904" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091569"
FT                   /db_xref="GeneID:8402004"
FT                   /translation="MYEIRQIIQRLRLGESNRAVARSQGVGRDTVAQLRNLAASQNWLD
FT                   ATGPMPDDATIALHYRSTGKGATEGPIKNPSHVSTVEPFREDVLAWHRQGIQVSSIRQA
FT                   LARQHGYDGSVHALYRFIRREAPDAPVATVMLDFAVGEQAQVDFGSGPLITDRHSDEVF
FT                   KTWFFVMTLAWSRHQYAELVRNQSVETWLACHRHAFEWFNGVPRKVRIDNPKCAITRAC
FT                   YYEPTVQRAYGELALGYTFVIDPCPVADPAKKGRVEAGVKYVKRNFMPLREFHSLAHAN
FT                   EQLQTWVRDEAGNRIHGSTRERPLKRFNETEQALLQPLPAIAPACPTWAKAKLHGNCHV
FT                   QHEYCQYSAPFRLIHQTLWLEITPDALRIYQEHELVAIHPRLFKRGDHSTVQDHLPPHA
FT                   QAYFMRDPQWCLAQAMTIGPACLAVVESLFANRVLDHLRAAQGLLRLGDQFGRGRLDAA
FT                   CSRALNFGTPSYRTIKQILNTGLDQQPELIESPALDAPYLDGGRFSRSPNDSLH"
FT                   /protein_id="YP_003165212.1"
     atgtacgaga tacgacaaat catccagcgc ttgagactgg gcgagagcaa tcgcgcggtc        60
     gcccgatcgc aaggggtcgg gcgcgacacg gtcgcgcagc tacgaaacct cgcagccagc       120
     cagaactggc tagacgcgac gggcccgatg cctgacgatg ccaccattgc cctgcattac       180
     cggagcactg gcaaaggggc aaccgagggt ccgatcaaga atccgagcca tgtgtcgacg       240
     gtggagccct ttcgcgagga cgttctggcg tggcacagac agggcatcca ggtcagtagc       300
     atccgccagg cgttggctcg ccagcatggc tacgacggga gcgttcacgc cctctaccgg       360
     ttcattcggc gggaagcgcc cgacgctccc gtggcgacgg tgatgctcga ctttgccgtc       420
     ggcgaacagg cccaagtgga ctttggctca gggccgctga tcaccgaccg gcactccgac       480
     gaagtcttca agacctggtt cttcgtcatg accctggcct ggagccgaca ccagtacgcc       540
     gagctcgttc ggaatcagag cgtcgaaacc tggctggcct gtcaccgtca cgccttcgag       600
     tggttcaacg gggtgccgcg caaggttcgc atcgataacc cgaaatgcgc catcacgcgc       660
     gcctgctact acgagccgac cgtgcagcgg gcctacgggg aactcgctct tggctacacc       720
     ttcgtgatcg acccctgtcc ggtcgcggac cccgccaaga agggccgcgt cgaggcgggc       780
     gtcaaatatg tcaagcgcaa cttcatgccg ctacgcgagt tccatagcct ggcgcacgcc       840
     aatgagcagt tgcagacctg ggtccgggac gaggcgggaa accggataca cggtagcacg       900
     cgcgagcggc cactcaagcg gttcaatgaa accgagcagg ccctcttgca gccgctgccg       960
     gccatcgccc cggcatgccc gacctgggcc aaggcgaaac tgcatggcaa ctgtcatgtc      1020
     cagcacgagt actgccagta ttccgcgccg tttcgcctga tccaccagac gctctggctg      1080
     gagatcacgc cggatgcact gcgcatctat caggagcatg agctggtcgc gatccatccg      1140
     cgcctgttca agcgcgggga ccattccacc gtacaggatc acctgccgcc ccatgcccag      1200
     gcctacttca tgcgcgatcc gcagtggtgc ctggcgcagg ccatgaccat cgggccggcc      1260
     tgtctggcgg tggtcgagag cctgttcgcc aaccgcgtgc tcgaccacct gcgcgccgct      1320
     caggggctcc ttcgactcgg cgaccagttc ggacgcggcc ggctggacgc ggcctgtagc      1380
     cgtgcgctga actttggcac gccaagctat cgcacgatca agcagatcct caataccggg      1440
     ctcgatcagc aacccgagct gatcgagtca cccgcgctgg acgcgcctta tctggacggg      1500
     ggccgtttca gccgtagtcc caacgactct ctccattga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page