(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE66

ACCPU_3.PE66         Location/Qualifiers
FT   CDS_pept        complement(72537..73262)
FT                   /locus_tag="CAP2UW1_4637"
FT                   /gene_family="HOG000229833" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TraL"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091571"
FT                   /db_xref="GeneID:8402006"
FT                   /translation="MAKIHMVLQGKGGVGKSFIATVIAQYKISKGQQPLCIDTDPVNAT
FT                   FHGFKALNVRLLEIMQGDEIQTRNFDTLVELIAPSKDDVIIDNGASSFVPLTHYLISNQ
FT                   VPALLQEMGHEMVVHTVITGSQALLDTVSGFAQLASQFPAEALFVVWLNPFWGSIEHEG
FT                   KGFEQMKAYTANKARVSAIVTIPALKEDTYGRDLSDMLLERLTFDEALAMDSLTIMTRQ
FT                   RLKIVKGQLFSQLDSAAVL"
FT                   /protein_id="YP_003165214.1"
     atggccaaga ttcacatggt tctgcaaggc aagggcggcg tcggcaagtc gttcatcgcg        60
     acggtgattg cgcagtacaa gatcagcaag gggcaacagc ccctgtgcat cgacactgac       120
     ccggtgaacg ccaccttcca cggcttcaag gcgctcaacg tccggctcct ggaaatcatg       180
     cagggcgacg agatccagac ccgcaacttc gacaccctgg tcgaactgat tgccccgtcg       240
     aaagacgacg tgataatcga caacggcgcc agttccttcg taccgctgac gcactacctg       300
     atcagcaacc aggtgccggc gctgctgcag gagatggggc acgagatggt ggtgcacacc       360
     gtgatcacgg gcagccaggc cctcctcgac acggtcagcg gcttcgccca gctcgccagc       420
     cagttcccgg ccgaagcgct cttcgtggtc tggctcaatc cgttctgggg atcgatcgag       480
     cacgagggca agggctttga gcagatgaaa gcctacacgg ccaacaaggc gcgggtgtcg       540
     gcgatcgtga cgatcccggc tctcaaggaa gacacctacg gccgcgatct gagcgacatg       600
     ctgctggaac gtctgacctt cgacgaagcc ctggcgatgg actccctgac gatcatgacg       660
     cggcagcgcc tcaagatcgt caaagggcag ctgttcagcc aactggacag cgcggcggtg       720
     ttgtga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page