(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE67

ACCPU_3.PE67         Location/Qualifiers
FT   CDS_pept        complement(73262..73660)
FT                   /locus_tag="CAP2UW1_4638"
FT                   /gene_family="HOG000229834" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091572"
FT                   /db_xref="GeneID:8402007"
FT                   /translation="MAKSLSARIAERIARKKPAGNVRNRAAFLALRGEVKQAIDDGWPV
FT                   KTIWETLHDEEKVAFSYQAFRGYVNRLILSPPADGQAAPVPVVADQPRQVASRLAPQSA
FT                   TNPAERKAEKPTATGFTFNRTPKKEDLL"
FT                   /protein_id="YP_003165215.1"
     atggccaaga gcttgtcggc gcgcatcgct gaacggatcg cgcgcaagaa gccggccggc        60
     aatgtgcgca accgggcggc gttcctggct ctgcgtggcg aggtgaagca ggccatcgac       120
     gatggctggc cggtcaagac gatctgggaa acgctgcacg acgaagagaa ggtcgccttc       180
     agctaccagg cgtttcgcgg ctacgtgaat cgcttgattc tgtcgccgcc ggcagacgga       240
     caagctgcgc cggtgccggt ggtggccgat cagcccaggc aggtggcctc gaggttggcc       300
     ccgcagtcag ccacaaaccc ggccgaaagg aaagcagaga agccaaccgc gaccggcttc       360
     acattcaacc gaacaccgaa gaaggaggat ttactctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page