(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE7

ACCPU_3.PE7          Location/Qualifiers
FT   CDS_pept        complement(7542..8204)
FT                   /locus_tag="CAP2UW1_4574"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091512"
FT                   /db_xref="GeneID:8401947"
FT                   /translation="MGVSVVTGANRGIGLELAQQLKARGASVVAVCRKGSPELDALGVR
FT                   VESQINLTERLAWSKIAERLAHDEIDLLIHNAGVLMADSLEEVDPDEVRAQFEVNAVAP
FT                   LFLTRALASRLHPGSKVALITSRMGSMGDNTSGGYYGYRMSKAALNAAGVSLAHDLKPR
FT                   GVAVVILHPGFVRTAMTRGHGQIDPDESVRGLLQRIDELKIETTGRFLHQNGDILPW"
FT                   /protein_id="YP_003165155.1"
     atgggtgttt cagtcgtcac aggtgccaat cgtggaatcg gccttgagct cgcgcaacag        60
     ctcaaggcac gtggagcgag cgtggttgcg gtatgtcgca agggttcgcc ggagcttgac       120
     gcgctcgggg tgcgtgtcga aagccagatc aacctgacag agcgtctggc atggtccaag       180
     atcgccgaac ggctcgcgca cgacgagatt gacctcctga tccacaacgc cggcgtgctc       240
     atggccgact ctctcgaaga ggtcgatcct gacgaggtgc gcgcgcagtt cgaagtgaac       300
     gccgtagcgc cactttttct cacgagggcc ctcgcctcgc gcctgcatcc gggctcgaag       360
     gtcgcgctca tcaccagtcg catgggctcc atgggcgaca atacctccgg gggctactac       420
     ggctaccgaa tgagcaaggc cgcgctcaat gcggccggtg tctccctcgc ccacgacctt       480
     aagccgcgag gggtcgctgt ggtcatcttg catccagggt ttgtgcgcac cgcgatgacc       540
     cgcggccacg gccagatcga tccggacgag tctgttcgcg ggctcttgca gcgcatcgac       600
     gaactgaaga tcgagaccac cggacgattc ctccaccaga atggcgacat cctgccgtgg       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page