(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE70

ACCPU_3.PE70         Location/Qualifiers
FT   CDS_pept        76633..78543
FT                   /locus_tag="CAP2UW1_4641"
FT                   /gene_family="HOG000289392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal transfer coupling protein TraG"
FT                   /transl_table="11"
FT                   /note="type IV secretion system VirD4 family"
FT                   /db_xref="GI:257091575"
FT                   /db_xref="GeneID:8402010"
FT                   /translation="MKDQFNNAVGPQVRGSTPKAGKLIPALVVVSLAAGLQSATQFFAH
FT                   DFGYQAALGRHFEHLYVPWSILQWAGQWYGQYPEAIMRAGSVGMIVTTLGLLGLAVSRM
FT                   VLANSSRLNPYLHGSARWANLKDIQASGLLPRPRTFWQALTGARPAASAGVYVGAWLDP
FT                   RGHSHYLRHNGPEHVLCYAPTRSGKGVGLVVPTLLSWGESAVITDLKGELWALTAGWRR
FT                   QHAKNQVLRFEPAAASGSVCWNPLDEIRIGTEHEVGDVQNLATLIVDPDGRGLESHWQK
FT                   TSQALLVGVILHALYKAANEGTAATLPAVDALLADPDRDVAELWMEMRTYGHLDGQNHP
FT                   AVGSAARDMMDRPDEEAGSVLSTAKSYLAVYRDPVVARNVSKSEFRIRDLMHHAQPVSL
FT                   YILTQPNDKTRLRPLVRVMVSMIVHLLADKLHFENGRPVAHYRHRLLMMLDEFPSLGKL
FT                   EILQESLAFVAGYGIKCYLVCQDINQLKSRETGYGHDESITSNCHVQNAYPPNRVETAE
FT                   HLSKLTGQTTVAKEQITTSGRRASALLGQVSRTIQEVQRPLLTPDECLRMPGPIKNAHG
FT                   DIEEAGDMVVYVAGYPAIYGKQPLYFKDPIFQARAAIPAPQDSDKLIHVHDVPAGEGIT
FT                   L"
FT                   /protein_id="YP_003165218.1"
     ATGAAAGACC AGTTCAACAA CGCCGTCGGA CCCCAGGTGC GAGGATCGAC GCCGAAGGCC        60
     GGCAAGCTCA TCCCGGCGTT GGTCGTGGTT TCCCTGGCGG CCGGCCTGCA ATCCGCCACC       120
     CAGTTCTTCG CGCACGATTT CGGCTACCAG GCGGCACTGG GCCGTCACTT CGAGCACCTG       180
     TATGTGCCGT GGTCGATCCT GCAATGGGCT GGCCAGTGGT ACGGGCAGTA CCCGGAGGCG       240
     ATCATGCGCG CCGGCAGCGT CGGCATGATC GTCACCACCC TGGGCCTGCT CGGCCTGGCG       300
     GTTAGCCGGA TGGTCCTGGC CAACTCGTCC CGGCTGAACC CTTACCTGCA CGGTTCGGCC       360
     CGCTGGGCCA ACCTGAAGGA CATCCAGGCG TCTGGCCTGC TGCCCCGGCC GCGAACGTTC       420
     TGGCAGGCGC TCACCGGCGC CCGGCCGGCG GCCAGTGCCG GCGTCTATGT CGGTGCCTGG       480
     CTGGACCCGC GGGGTCATTC GCATTACCTG CGCCACAACG GCCCGGAGCA TGTCCTGTGC       540
     TACGCGCCGA CCCGTTCCGG CAAGGGCGTC GGCCTGGTGG TGCCGACCCT CCTGTCGTGG       600
     GGCGAGAGCG CCGTCATCAC CGACCTGAAG GGCGAGCTCT GGGCCTTGAC CGCCGGCTGG       660
     CGCCGGCAGC ACGCGAAAAA CCAGGTGCTG CGCTTCGAGC CCGCCGCGGC CAGCGGCAGC       720
     GTCTGCTGGA ACCCTCTGGA CGAAATCCGC ATCGGCACCG AGCACGAGGT TGGCGACGTG       780
     CAGAATCTCG CCACGCTGAT CGTCGACCCG GACGGCCGCG GCCTGGAATC ACACTGGCAG       840
     AAAACCAGCC AGGCGCTGCT GGTCGGCGTC ATCCTGCACG CGCTCTACAA GGCCGCCAAC       900
     GAGGGCACGG CGGCCACCCT GCCGGCCGTC GATGCCCTGC TGGCCGATCC AGACCGCGAT       960
     GTCGCCGAGC TCTGGATGGA GATGCGCACC TACGGCCACC TTGACGGCCA GAACCATCCG      1020
     GCCGTCGGAT CGGCCGCCCG CGACATGATG GATCGCCCCG ACGAAGAAGC CGGGTCGGTC      1080
     CTGTCCACGG CCAAGTCGTA CCTGGCGGTG TACCGCGATC CCGTCGTCGC GCGCAACGTC      1140
     AGCAAGTCCG AATTCAGGAT CCGGGACCTG ATGCACCACG CGCAGCCGGT CAGCCTGTAC      1200
     ATCCTCACCC AGCCGAACGA CAAGACCCGT CTGCGGCCGC TGGTGCGCGT CATGGTCAGC      1260
     ATGATCGTCC ACCTCCTGGC CGATAAGCTG CACTTCGAGA ACGGCCGGCC GGTCGCCCAC      1320
     TACCGGCACC GCCTGCTGAT GATGCTCGAC GAGTTCCCCA GCCTGGGGAA ACTCGAAATC      1380
     CTGCAGGAGT CGCTGGCCTT CGTCGCCGGC TACGGGATCA AGTGCTACCT GGTCTGCCAG      1440
     GACATCAACC AGCTCAAGAG CCGCGAAACC GGCTACGGCC ACGACGAAAG CATCACCTCG      1500
     AACTGCCACG TGCAGAACGC CTACCCGCCG AACCGGGTAG AGACCGCCGA GCACCTTTCC      1560
     AAACTGACCG GGCAAACCAC CGTCGCCAAG GAGCAGATCA CCACCAGCGG CCGGCGCGCG      1620
     AGCGCCTTGC TGGGGCAGGT GTCGCGCACC ATCCAGGAGG TGCAGCGCCC GCTGCTGACC      1680
     CCGGACGAGT GTCTGCGCAT GCCGGGCCCG ATCAAGAACG CCCACGGCGA CATCGAAGAA      1740
     GCCGGCGACA TGGTCGTGTA CGTTGCCGGC TATCCCGCGA TCTACGGCAA GCAGCCGCTC      1800
     TACTTCAAGG ACCCGATATT CCAGGCCCGC GCCGCGATCC CGGCACCGCA GGACAGCGAC      1860
     AAGCTGATCC ACGTCCACGA CGTGCCGGCA GGGGAGGGCA TCACTCTATG A               1911
//

If you have problems or comments...

PBIL Back to PBIL home page