(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE72

ACCPU_3.PE72         Location/Qualifiers
FT   CDS_pept        79120..79407
FT                   /locus_tag="CAP2UW1_4643"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091577"
FT                   /db_xref="GeneID:8402012"
FT                   /translation="MNDPNTLPKNDVTFAERADDQANAADDQPNAADALREKLLDAMTP
FT                   GYQAEFDPDEAEKAGAFIEDALSEQDAAESDIDLVDTTAAVATTTTKARR"
FT                   /protein_id="YP_003165220.1"
     ATGAATGACC CAAACACACT TCCCAAGAAC GACGTGACCT TCGCCGAGAG GGCCGACGAT        60
     CAGGCCAACG CAGCCGACGA CCAGCCCAAC GCCGCCGACG CGCTGCGCGA GAAGCTGCTC       120
     GACGCGATGA CGCCCGGCTA TCAGGCCGAG TTCGACCCCG ACGAGGCCGA AAAGGCCGGC       180
     GCCTTCATCG AAGACGCCTT GAGCGAGCAG GATGCCGCCG AGAGCGACAT CGACCTGGTG       240
     GATACCACCG CGGCGGTCGC CACGACCACC ACCAAGGCGA GGAGGTGA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page