(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE73

ACCPU_3.PE73         Location/Qualifiers
FT   CDS_pept        79413..82124
FT                   /locus_tag="CAP2UW1_4644"
FT                   /gene_family="HOG000229807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091578"
FT                   /db_xref="GeneID:8402013"
FT                   /translation="MADTKKAFHEQVAEKLIEQLRQGTAPWQRPWEAGEAASLLPINPT
FT                   TGKRYRGINAIQLLSQGRVDRRWLTYKQAAAAGAQVRKGEHGTAIQYWKFSEEQTRTDE
FT                   SGKPVLDAQGQPVKAEVRLERPRVFFATVFNAEQIDGLPAMQRREQTWDAVERAEAILQ
FT                   ASRAVIQHGGQNRAFYRLRTDSIHLPDKGQFPSADNYYAIALHELGHWTGHPSRLDRDL
FT                   AHPFGSEGYAKEELRAEIASMILGDELGIGHDPGQHAAYVGTWINVLRDDPLEIFRAAA
FT                   DAEKIHGYVLALEQQQVQEQTSQQAQTQDSAQNQGSAENHDNTENQEAAMKSFTQTPVL
FT                   ASAALNSTDGEAAVADPRLDPINPHEQAARLARIEEERVRRDPNSTDEDIAAAREARKS
FT                   ADVAALLNDKDLQRQIAEHEREQQTTQAGQVDQASQSSKIWIDVPYPQKDEAKALGARW
FT                   DRQEQSWYVPAGVDPAPFARWTPAAAPQARPKQSPATPPRQYLAVPYGERVAAKAAGAV
FT                   WDKAAKSWYAGPKADLAKLKRWKPENVPTQQGPAMTPRDEFAEALRSIGCVVSGDHPIM
FT                   DGQKHRISVEGEKHSEKSGSGFYVGHLDGHPAGYMKNNKIGIDLKWKSKGYTFEPEQKA
FT                   RMLAEAAEKLQARTAEQERLHEQTAQRVARQMAKLLPVIEPTAYMNAKGIEPQPGVFTD
FT                   REGQKTYIPATDVDGKQWTMQYIREDGSKRFAKDSRKEVCFHAIGGLDALAKAPVLVIG
FT                   EGYATAGSLSQTLGFATVAAFDSGNLVPVAKALHEKYPDKPIVIAGDDDKHLEATQGVN
FT                   PGRSKAEEAARAVGGKLLLPIFAPGEQAANPKGFTDFNDLATKSVLGQEGIARQVRSVV
FT                   DDVIEWQRGRSVEGRARGERQEQAVRRVAKVG"
FT                   /protein_id="YP_003165221.1"
     ATGGCCGACA CCAAGAAAGC CTTTCACGAA CAGGTGGCCG AGAAGCTGAT CGAGCAACTG        60
     CGGCAGGGCA CCGCGCCATG GCAGCGGCCG TGGGAAGCGG GCGAGGCGGC TTCCCTGCTC       120
     CCGATCAACC CGACTACCGG CAAGCGCTAT CGCGGCATCA ACGCCATCCA GTTGCTGAGC       180
     CAGGGCCGTG TCGATCGACG CTGGCTGACC TACAAGCAGG CCGCTGCTGC CGGTGCGCAG       240
     GTGCGCAAGG GCGAGCACGG CACGGCCATC CAGTACTGGA AGTTCAGCGA GGAACAAACC       300
     CGGACCGACG AGAGCGGCAA GCCCGTCCTC GATGCCCAGG GCCAGCCGGT CAAAGCGGAA       360
     GTGCGGCTGG AGCGGCCGCG GGTGTTCTTC GCCACCGTCT TCAACGCCGA GCAGATCGAC       420
     GGCCTGCCGG CGATGCAACG CAGGGAACAG ACCTGGGACG CCGTCGAGCG CGCCGAAGCC       480
     ATCCTGCAGG CGTCCCGGGC CGTGATCCAG CACGGGGGGC AGAACCGCGC CTTCTACCGC       540
     TTGCGGACCG ACAGCATCCA CCTTCCCGAC AAGGGCCAGT TTCCTAGCGC CGACAACTAT       600
     TACGCGATCG CACTGCACGA ACTCGGGCAC TGGACTGGCC ACCCATCACG CCTGGATCGC       660
     GACCTGGCGC ATCCTTTTGG CAGCGAGGGC TACGCGAAGG AGGAACTGCG GGCCGAAATC       720
     GCCAGCATGA TCCTGGGCGA CGAACTCGGA ATCGGCCACG ATCCCGGCCA GCACGCGGCC       780
     TACGTCGGCA CGTGGATCAA TGTCCTGCGG GACGATCCGC TGGAGATTTT CCGGGCCGCG       840
     GCCGACGCCG AGAAGATCCA CGGCTACGTG CTGGCTCTCG AACAACAGCA GGTTCAAGAA       900
     CAGACCAGCC AGCAGGCACA GACCCAGGAC AGTGCACAGA ATCAGGGTAG CGCAGAGAAC       960
     CACGACAACA CAGAGAATCA GGAGGCGGCC ATGAAGAGCT TCACGCAGAC CCCCGTGCTC      1020
     GCGAGCGCGG CGCTCAACTC GACCGATGGC GAAGCGGCAG TTGCCGACCC CCGCCTCGAC      1080
     CCGATCAACC CGCACGAGCA AGCGGCCCGG TTGGCACGAA TCGAGGAAGA ACGGGTGCGC      1140
     CGCGACCCCA ACAGCACCGA TGAGGACATT GCCGCCGCCC GAGAAGCGCG CAAGTCGGCC      1200
     GACGTCGCCG CGCTCCTCAA TGACAAGGAC CTGCAACGGC AGATCGCTGA ACACGAACGC      1260
     GAGCAGCAGA CTACCCAGGC CGGTCAGGTA GACCAGGCCA GCCAGTCCAG CAAGATCTGG      1320
     ATCGACGTTC CCTACCCGCA GAAGGACGAG GCGAAAGCGC TGGGTGCGCG GTGGGATCGT      1380
     CAGGAACAGT CCTGGTATGT CCCGGCCGGT GTGGATCCAG CCCCCTTTGC CCGGTGGACG      1440
     CCGGCGGCTG CTCCCCAGGC CCGACCCAAG CAGTCGCCAG CCACCCCGCC GCGCCAGTAT      1500
     CTTGCCGTTC CCTACGGCGA ACGCGTCGCC GCCAAGGCGG CCGGCGCCGT GTGGGACAAA      1560
     GCCGCGAAGT CCTGGTACGC CGGGCCAAAA GCCGACCTGG CCAAGCTCAA GCGCTGGAAG      1620
     CCCGAGAACG TGCCCACTCA GCAAGGCCCG GCGATGACGC CGAGGGACGA GTTCGCCGAA      1680
     GCACTGCGCT CGATCGGCTG CGTGGTGAGC GGCGACCACC CGATCATGGA CGGCCAGAAG      1740
     CACCGCATCA GCGTCGAAGG CGAGAAACAC AGCGAGAAAT CCGGGTCGGG CTTCTATGTC      1800
     GGCCACCTGG ACGGCCACCC GGCTGGCTAC ATGAAGAACA ACAAGATCGG CATCGACCTG      1860
     AAGTGGAAAT CGAAGGGCTA CACGTTCGAA CCCGAGCAGA AAGCCCGGAT GCTCGCCGAG      1920
     GCGGCCGAGA AGCTGCAAGC CAGAACCGCC GAACAAGAGC GGCTGCACGA GCAGACCGCG      1980
     CAGCGTGTCG CCCGGCAGAT GGCGAAGCTG CTGCCGGTCA TCGAGCCGAC CGCGTACATG      2040
     AACGCCAAGG GCATCGAACC ACAGCCCGGC GTCTTCACCG ACCGCGAAGG CCAGAAAACC      2100
     TACATCCCGG CCACCGACGT CGACGGCAAG CAATGGACGA TGCAGTACAT CCGCGAGGAC      2160
     GGCAGCAAGC GCTTCGCCAA GGACAGCCGC AAGGAGGTCT GCTTCCATGC GATCGGCGGC      2220
     CTGGACGCGC TGGCCAAGGC ACCCGTCCTG GTCATCGGAG AAGGCTACGC CACCGCCGGC      2280
     AGCCTGTCAC AAACGCTGGG CTTCGCGACC GTCGCCGCCT TCGACTCGGG GAATCTGGTG      2340
     CCCGTCGCCA AGGCCCTGCA CGAGAAGTAC CCGGACAAAC CGATCGTGAT CGCCGGCGAC      2400
     GACGACAAGC ACCTGGAAGC CACCCAGGGC GTGAACCCCG GCCGCAGCAA GGCCGAGGAA      2460
     GCCGCCCGGG CGGTCGGCGG CAAGCTGCTA CTGCCGATCT TCGCGCCCGG CGAGCAAGCC      2520
     GCGAACCCCA AGGGCTTCAC CGACTTCAAT GACCTGGCTA CCAAGAGCGT GCTCGGGCAG      2580
     GAAGGGATTG CGCGGCAGGT TCGGTCGGTG GTTGATGACG TGATCGAGTG GCAGCGGGGG      2640
     CGCAGTGTCG AGGGGCGGGC GCGCGGGGAA AGGCAGGAGC AGGCAGTGCG TCGGGTAGCG      2700
     AAGGTCGGAT GA                                                          2712
//

If you have problems or comments...

PBIL Back to PBIL home page