(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE74

ACCPU_3.PE74         Location/Qualifiers
FT   CDS_pept        83943..84335
FT                   /locus_tag="CAP2UW1_4646"
FT                   /gene_family="HOG000110426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091579"
FT                   /db_xref="GeneID:8402101"
FT                   /translation="MKTNFSKLALIAAIGLAAAGTSYAHEDYSEARIDHWLRHVSESQS
FT                   APTANQLAPFGYAATKNADREVSLPSGGKYLNVTRLETLKLNVDGKSVVWTFDTLGTAA
FT                   FPLSTIVPGADGITVYVRENPAYQGG"
FT                   /protein_id="YP_003165222.1"
     ATGAAAACGA ATTTTTCCAA ACTTGCCCTG ATCGCTGCGA TCGGCCTCGC TGCCGCCGGA        60
     ACGAGCTACG CGCACGAAGA TTATTCCGAA GCCCGCATCG ACCACTGGCT GCGCCACGTT       120
     TCGGAAAGCC AGAGCGCTCC GACGGCCAAT CAACTGGCTC CGTTCGGCTA CGCCGCCACG       180
     AAAAATGCCG ACCGCGAGGT CAGCCTGCCC AGCGGTGGCA AGTATCTCAA CGTCACGCGC       240
     CTGGAAACTC TCAAGCTCAA TGTCGATGGC AAGAGTGTTG TCTGGACCTT CGATACGCTC       300
     GGCACGGCGG CCTTTCCGCT CTCCACGATC GTACCGGGAG CCGATGGCAT CACCGTTTAT       360
     GTAAGAGAAA ACCCCGCCTA CCAGGGGGGC TGA                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page