(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE75

ACCPU_3.PE75         Location/Qualifiers
FT   CDS_pept        84441..84728
FT                   /locus_tag="CAP2UW1_4647"
FT                   /gene_family="HOG000229130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091580"
FT                   /db_xref="GeneID:8402015"
FT                   /translation="MMKKMLMVALMSAVSVTAFASDAARAAAKQVIELKDGSTVYIFKD
FT                   GKMGMEDKLGRAIRMEKGMVMETKDGQKIIMHGDEVMRLNPLLREGHRGP"
FT                   /protein_id="YP_003165223.1"
     ATGATGAAAA AAATGCTGAT GGTTGCCCTG ATGAGCGCGG TCTCAGTGAC CGCATTCGCA        60
     TCCGATGCTG CTCGCGCTGC TGCAAAGCAA GTGATTGAGC TGAAGGATGG CTCGACGGTC       120
     TACATTTTCA AGGATGGGAA AATGGGCATG GAGGACAAAC TCGGTCGTGC GATTCGCATG       180
     GAGAAAGGCA TGGTGATGGA AACCAAGGAT GGTCAGAAGA TCATCATGCA CGGCGACGAA       240
     GTCATGCGCC TCAACCCACT GCTACGCGAA GGGCATCGCG GTCCTTGA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page