(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE76

ACCPU_3.PE76         Location/Qualifiers
FT   CDS_pept        complement(84738..86045)
FT                   /locus_tag="CAP2UW1_4648"
FT                   /gene_family="HOG000224357" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091581"
FT                   /db_xref="GeneID:8402016"
FT                   /translation="MKTIELPETPRQLHHLLARRLGIGALLVGSLAGGLAYWVESYRVE
FT                   QRTLERAITGVRHFESPAMQLAVGGEKGDGHSAISQLLTDEFVGIRVFASNAEMLFDVW
FT                   RPLPETLKEFARQQRHPWPIPPNSHSKRIPVAGEELVQVILPMTTNDGRLVGYVEGISL
FT                   VSQSALHERKLQTRGAALTATISVLAAALLLYPLMSGLLGRTVALSSRLLDANLSLLRS
FT                   LGNAIAKRDADTDAHNYRVTCYAVTLAEAVGVDKETVTELVLGAFLHDVGKIGIPNQIL
FT                   LKPGRLTSEEFQVMQTHAVLGIEIVAGNPWLSGAEKTIRHHHERFDGKGYPDGLSGKAI
FT                   PLAARIFALVDVFDALTSVRPYKPALSLDETLSIMEREAGQHFDPAIYAVFRQIAPMLY
FT                   EQGQSRDHTQWILELKVMLERCFKMKTAPEGAVEFA"
FT                   /protein_id="YP_003165224.1"
     atgaaaacca ttgaactccc tgaaactccc cggcaattgc accacctgtt ggcacgacgc        60
     cttggcatcg gtgcgcttct ggttggcagt ctcgcgggag gtcttgccta ctgggtcgaa       120
     tcgtatcgcg tcgagcagcg tactcttgag cgcgctatta cgggggtcag gcatttcgag       180
     tcgcctgcaa tgcagttggc ggtcggcggt gagaaaggag atggtcattc cgcgatttcg       240
     cagttgctga ccgacgagtt tgtcgggatt cgagtttttg catccaatgc cgagatgctg       300
     ttcgacgtct ggcgaccact gcccgaaaca ttgaaagagt ttgcccgaca gcagcgccat       360
     ccatggccaa tcccgcccaa tagccatagc aagcgaatcc ccgtggcagg agaagaactg       420
     gtccaggtca ttctgccgat gaccacgaat gatggccgtc ttgtgggcta tgttgagggg       480
     atcagcctgg tttcccagtc agccttgcat gagagaaaac ttcagactcg tggggctgcg       540
     ctaacagcca cgatttcggt actcgccgcg gcactgctgc tctatccatt gatgtcagga       600
     ttgctggggc gtacggtggc attgtcgtct cgactcctgg acgccaatct ctcactgctg       660
     cgatctctcg gaaacgccat cgccaagcgt gacgcggaca ccgacgccca taactaccgg       720
     gttacctgct atgcggtcac acttgctgaa gcggtgggcg ttgacaagga aaccgttacc       780
     gaactggtgc tgggcgcctt tctccacgac gttggaaaaa tcggtatccc gaatcagatt       840
     ttgttgaaac cgggacggct gaccagcgaa gaattccagg tcatgcagac ccacgcagtg       900
     ctgggcatcg agattgtcgc tggcaatccc tggctgtccg gtgccgagaa gaccatccgg       960
     catcatcacg aacgctttga cgggaaaggc tatccagacg gactttcagg aaaggcgata      1020
     ccgctcgctg caagaatctt tgccctggtg gacgtgttcg atgcattgac ctccgttcgt      1080
     ccctacaaac cagctttgtc attggacgag acgctgagca tcatggaacg ggaggctggg      1140
     cagcatttcg acccggcgat ctatgccgtc ttccgccaga ttgctccgat gctatacgag      1200
     caaggccagt ccagagatca cacccaatgg atactggaac tgaaggtgat gcttgaacgg      1260
     tgcttcaaaa tgaaaacggc ccccgaagga gccgtcgaat ttgcgtga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page