(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE77

ACCPU_3.PE77         Location/Qualifiers
FT   CDS_pept        complement(86042..86401)
FT                   /locus_tag="CAP2UW1_4649"
FT                   /gene_family="HOG000257191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091582"
FT                   /db_xref="GeneID:8402017"
FT                   /translation="MLGVRAYRQQLLASNIANADTPGYKAVDIDINEAARVVTSTAASL
FT                   SLATTANGHLSGGTQAPPFPLKFHVPYQAAADGNTVEMDVERQKFSENSLMYQFSLDRV
FT                   SGHFKHLMELLQNLK"
FT                   /protein_id="YP_003165225.1"
     atgcttgggg ttcgggcgta tcggcagcaa cttctggcct cgaatatcgc caatgccgat        60
     acgcctggct acaaggcggt cgatatcgac atcaatgagg ccgcccgagt cgtcacgagc       120
     acggcggcat cgctatcgtt ggccactacc gctaatggcc atctgtcagg gggaacgcag       180
     gcaccaccgt tcccgctgaa gttccatgta ccgtatcaag ccgcagccga tggtaatacg       240
     gtggagatgg atgttgagcg acagaagttt tccgaaaact cactgatgta ccaattttcc       300
     cttgatcggg tcagcgggca tttcaagcat ctcatggaat tactacagaa tttgaaatga       360
//

If you have problems or comments...

PBIL Back to PBIL home page