(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE78

ACCPU_3.PE78         Location/Qualifiers
FT   CDS_pept        complement(86689..86931)
FT                   /locus_tag="CAP2UW1_4650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091583"
FT                   /db_xref="GeneID:8402018"
FT                   /translation="MDIRKPAEHGNRCVCRNLALAVGCDPKMLNYNYCRTVLQKRWIVE
FT                   CNHGCLAEIPMADIGLKWHDVGQIDPVKAILIMNG"
FT                   /protein_id="YP_003165226.1"
     atggacatcc gcaaaccggc agagcacggc aatcgatgtg tgtgtcgcaa tctagcactc        60
     gcggtcgggt gtgacccgaa gatgctgaat tacaactatt gtcggacggt gcttcagaaa       120
     cgctggatcg tcgaatgcaa ccatggctgc ctggcagaga ttcctatggc ggacattggt       180
     ctgaaatggc atgacgtcgg ccaaattgat ccagtgaagg ccatcctgat catgaacggg       240
     tag                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page