(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE79

ACCPU_3.PE79         Location/Qualifiers
FT   CDS_pept        complement(87600..89183)
FT                   /locus_tag="CAP2UW1_4652"
FT                   /gene_family="HOG000004065" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091584"
FT                   /db_xref="GeneID:8402102"
FT                   /translation="MHLSKHDLFQMNDEWLKKLPAELLLEVSKRLLHDVKELQDRLNQN
FT                   PDNSSRPPTSQPPWAKTGGSEEQNGAADERGNADVAAETAGSSTEETEQAPPVDGQRQS
FT                   AKKGSGKRPGKQPGSPGHGRSQKLAITARCEHRPEICAACAAVLSADAASQAYTAWDEV
FT                   DIAPPVESLIGLTFSVTRHTLLEVSCSCGHVSRAQAWRAPADGQWEKVELGEWRLVGPR
FT                   LAGVIVLLAVRMRLSRASIRELLMELFDLTLSTGVIDETIREAGRASLPLEDALVADIV
FT                   QAAQLHVDETSWPESGTLLWLWALVTTHTVLFLIGPRSREMLENALQDGFAGLLISDGY
FT                   GVYRAWANRLRCWPHLLRKLRGLAESSDARVSGVGQEMEGIMKTLMAAIYAARIDPPPE
FT                   GLPARYANEIERLRHLCEAHRMDDHSVLRSVVREFLYDWDVILRPVAEPHLPLSNNAAE
FT                   QALRHWVISRTISHGTRSEEGSRAFAFLASLIETCRRRGASAWQYLGTVIAAARKGLQL
FT                   PTIPAIPATA"
FT                   /protein_id="YP_003165227.1"
     atgcacctga gcaaacatga cctgttccag atgaacgacg agtggctgaa gaagctgccg        60
     gcggagcttt tgctggaagt gtcgaagcgg ctgttgcacg acgtaaagga gttgcaggat       120
     cggctgaatc agaacccgga caacagctcg cgtccgccga ccagccaacc gccctgggcg       180
     aagacaggtg gctcggagga acagaatggc gcggcggacg agcgcggcaa tgccgacgtc       240
     gccgcggaga cggctggaag ctctacggaa gagacggaac aggctccacc ggttgatggg       300
     cagcggcaat cggccaagaa ggggtctggg aagcggcccg gcaagcaacc gggcagtcca       360
     ggtcatggtc gcagtcagaa gctggcgatc accgcccggt gcgagcaccg tcccgagatc       420
     tgcgccgctt gtgcggcagt gttgtcggcg gatgccgcgt cgcaggctta cacggcttgg       480
     gacgaagtcg acattgcgcc gccggtcgag agcctgatcg ggttgacgtt cagcgtcacc       540
     cgtcacacgc tgcttgaagt gagctgctcc tgcggccatg tcagccgtgc gcaagcttgg       600
     cgggcgccgg ccgacgggca atgggagaag gttgagctcg gggaatggcg tctcgtgggt       660
     ccccggctgg ccggggtgat cgtcctgctg gcggtgcgca tgcgcctgtc gcgggcgagc       720
     attcgcgaat tgctgatgga actgttcgac ttgacgctga gtacgggcgt catcgacgaa       780
     accatccggg aagcgggccg cgccagtctg ccgctggagg acgccctggt ggccgacatc       840
     gtgcaggcag cgcaactgca tgtcgatgag acctcgtggc cggagtccgg cacgctgctg       900
     tggctgtggg cattggtgac gacccacacg gtgctgttcc tgatcggccc acgcagccgg       960
     gaaatgctgg agaacgccct gcaggacggc tttgccggcc tgctcatcag cgatggctac      1020
     ggcgtctatc gcgcctgggc aaaccgcttg cgttgctggc cgcacctgct gcgcaaactg      1080
     agagggctgg ccgaatcgag cgacgcgcga gtctccgggg tggggcaaga gatggaaggc      1140
     atcatgaaga cgctgatggc cgccatctac gcggcgcgga tcgatccgcc gccggaagga      1200
     ctcccggccc gctacgcgaa cgagattgag cgactgcggc acctgtgcga agcccatcgg      1260
     atggatgacc actcggtgct gcgtagcgtc gtgcgcgaat tcctctacga ctgggacgtg      1320
     atcctgcgtc ccgttgccga gccccacctg ccgctttcca acaacgccgc ggaacaggcg      1380
     cttcggcact gggtgatttc gcgcaccatc agccacggca cacgctctga agagggatcc      1440
     cgcgccttcg ctttcctcgc cagcctcatc gaaacctgtc gccgtcgcgg agcatccgcc      1500
     tggcagtacc tcggcaccgt catcgccgcc gcccgcaaag gcttgcagct ccccacgatc      1560
     cccgccatcc cggcaaccgc gtag                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page