(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE8

ACCPU_3.PE8          Location/Qualifiers
FT   CDS_pept        complement(8262..8783)
FT                   /locus_tag="CAP2UW1_4575"
FT                   /gene_family="HOG000118593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091513"
FT                   /db_xref="GeneID:8401948"
FT                   /translation="MSAPATPHRIEPLGKGHDRDSFCCGSAPLDRYLRQQARQDADKRV
FT                   AAPFVLIEPPAAQVLGYYTLSASTVDASELPDALTKKLPRYPQLPVTLLGRLAVDQSMK
FT                   GMGMGEFLLMDALRRSVEAAANIAAMAVLVDAKDEAAEAFYRHFSFLPLQQRPARLYLS
FT                   MKTIIALFGD"
FT                   /protein_id="YP_003165156.1"
     ttgtcggccc cggcgacccc gcatcgcatc gagcccctcg gtaagggcca tgaccgcgac        60
     agcttttgct gcggcagtgc gccgctggat cgctacctgc gccagcaagc ccgccaggac       120
     gccgacaagc gcgtcgccgc gcccttcgtt ctgattgagc cgcccgccgc gcaggtgctc       180
     gggtactaca cgctgtccgc ctcgacggtg gacgccagcg aattgcccga tgccttgacc       240
     aaaaagctgc cgcgctaccc gcaactcccg gtgacgctgc ttggtcggct ggccgtcgat       300
     caaagcatga agggcatggg catgggggaa ttcctgctca tggacgcctt gcgccgcagc       360
     gtggaagctg ccgcgaacat cgcggccatg gctgtcctgg tggatgccaa ggacgaagca       420
     gccgaagcct tctaccgcca tttcagcttc ctgccgctgc aacagcggcc cgcgcgcctg       480
     tacctgtcga tgaaaaccat catcgcgctg ttcggcgact ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page