(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE80

ACCPU_3.PE80         Location/Qualifiers
FT   CDS_pept        complement(90397..93531)
FT                   /locus_tag="CAP2UW1_4654"
FT                   /gene_family="HOG000126202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091585"
FT                   /db_xref="GeneID:8402103"
FT                   /translation="MLANIIGWSGRNRFLVLFATLFITIAGIYAVLRTPIDALPDLSDV
FT                   QVIVYTEYPGQAPQVVEDQVTYPLTTAMLSVPKSKVVRGFSFFGASFVYIIFEDGTDIY
FT                   WARSRVLEYLNFASSRMPKGVTPSLGPDATGVGWVYQYALLAKDKTLAELRTIQDWYVR
FT                   YQLTKAHGVAEVASIGGFVQTYQVTVDPVKLRSYGIPLMKVAQVIRDSNRDVGGRVVEM
FT                   AETEYMVRGKGYLRGKSDLEMLVVKSDKGTPVLIRDIARVELVPDERRGLTELNGEGEV
FT                   VSGIAMARYGANALEVIHNLKAKIDEIGGGLPAGVTVETVYDRSELIHRAIDTLKRTLI
FT                   EEAVIVALVCIVFLMHVRSALVAILMLPVGVLIAFIAMRSLGLNSNLMSLGGIAIAIGA
FT                   MIDAAIVMIENAHKHLERLPEGHTTAERADAMLAACKEVGPALFFSLLIITVSFLPVFA
FT                   LEGQEGRLFSPLAYTKTFSMAGAALLSVTLVPVLMMLFIRGKIMPEAKNPVNRFLIWVY
FT                   RPIIAGIMRWKKTTIVAAVVALVASIYPASQLGSEFMPTLNEGSLLYMPASLPGMSITK
FT                   AAELLQTQNKIIKSFPEVTSVYGKAGRANTATDPAPTEMFETVINLKPESEWRPGLTTD
FT                   KLIAELDKALQFPGVANSWTMPIKARIDMLSTGIRTPIGIKVFGKDLGEMEKVAREIEA
FT                   VVKAVPGTTSAYAERITGGFYLNIEPDREQLARYGLAVGDLQDVIGTALGGEMVTTTVE
FT                   GRERFGVSVRYPRELRSDPQQIAREVLIPTMDGAMIPLGQLARVGVAKGAPSIRTENAL
FT                   LSAYIFVDIRDRDIGSYVADAKKAVAEQVSFPPGYYVTWSGQFEYMERAIEKMKIVIPV
FT                   TLLSIFLLLYLNFKRLTETLIVMLSVPFALVGGVWLMWWLGYNLSVAVAVGFIALAGVA
FT                   AETGVIMLIYLDHAWEALKAKRRTDNQAPTLHDLYEAIMEGAVERVRPKMMTVVAIMAG
FT                   LLPIMWGTGTGSEVMSRIAAPMVGGMISSTVLTLAVIPAIYALVKQWRIKRGMEQ"
FT                   /protein_id="YP_003165228.1"
     atgttggcca atattatcgg atggtcgggc cggaaccgct tcctggtctt gttcgccacc        60
     ctattcatca ctatcgccgg catttatgcc gtattgcgca cgccgatcga tgccttgcct       120
     gacctctcgg acgtgcaggt catcgtctat accgagtatc ccggccaggc gccccaggtc       180
     gtcgaggatc aggtcaccta tccgctcact acagccatgc tgtcggtgcc gaaatcaaag       240
     gtggtgcgcg gtttttcgtt cttcggcgcc tccttcgtgt acatcatttt cgaggatggc       300
     accgacatct actgggcgcg ctcgcgcgtc cttgaatatc tcaatttcgc ctccagccgc       360
     atgccgaagg gcgtcacgcc gtcgcttggg ccggacgcca ccggcgtcgg ctgggtttac       420
     cagtacgcgt tgctcgccaa agacaagacg ctggccgaac tgcgcaccat tcaggattgg       480
     tacgtccgct atcaactgac caaggcccat ggtgtcgccg aagtggcctc gatcggcggc       540
     ttcgttcaga cctaccaggt caccgtcgac ccggtcaagc tgcgttccta cggcattccg       600
     ctgatgaagg tggcacaggt catccgcgac tcgaaccgcg atgtcggcgg acgcgtcgtc       660
     gagatggccg aaaccgagta catggtgcgc ggcaagggct acctgcgcgg caaaagcgat       720
     cttgaaatgc tagtcgtcaa aagcgacaag ggcacgccag tgctgatccg cgacatcgct       780
     cgcgtcgaac tggtgcctga tgaacggcgc ggcctgaccg aactcaacgg tgaaggcgaa       840
     gttgtgtcgg gcatcgccat ggcgcgctat ggcgccaacg cgctggaggt catccataac       900
     ctgaaagcca agatcgacga aatcggcggc ggcttgccgg ccggcgtcac cgtcgagacg       960
     gtgtacgacc gttccgaact gatacaccgc gccatcgaca cgttgaaacg gacgctgatt      1020
     gaggaagcgg tcatcgtcgc gctggtctgc atcgtcttcc tgatgcacgt gcgcagcgcg      1080
     ctggtcgcca tcctgatgtt gccggtcggc gtgctgatcg ctttcatcgc catgcgatcg      1140
     ctgggcctga actccaatct gatgagcctg ggaggcattg ccatcgccat tggcgccatg      1200
     atcgacgccg ccatcgtgat gatcgagaac gcccataaac acttggaacg cctgcccgaa      1260
     gggcatacca ccgccgagcg cgctgatgcg atgctcgccg cctgtaagga agtcggcccg      1320
     gcgctgttct tttccttgct catcatcacc gtctccttcc tgccggtgtt cgccctcgaa      1380
     ggccaggaag ggcggctgtt ctcgccgctc gcctacacca agaccttctc gatggccggc      1440
     gcggcgctgc tgtcggtgac gctggtgccg gtgctgatga tgctgttcat ccgcggcaag      1500
     atcatgccgg aagcgaagaa tccggtgaat cgcttcctga tctgggtcta ccggccgatc      1560
     atcgccggca tcatgcgctg gaagaaaacg accatcgttg ctgccgtcgt cgccttggtg      1620
     gcctcgattt acccggcctc tcaactcggc tcggagttca tgccgacgct caacgaaggt      1680
     tcgctgcttt acatgccggc gtccttgccc ggcatgtcga tcaccaaggc cgccgagctg      1740
     ctgcagacgc agaacaagat catcaagagc tttcccgagg ttacttcggt ctatggcaag      1800
     gccgggcgcg ccaatacggc gaccgatccg gcgccgaccg agatgttcga gacggtaatc      1860
     aacctgaagc cggagtccga atggcgcccg ggcctgacca ccgacaagtt gattgccgaa      1920
     ctcgacaagg ccctgcaatt ccccggcgtc gccaattcct ggacgatgcc gatcaaggcg      1980
     cgcatcgaca tgctgtccac cggcatccgc acgccgatcg gcatcaaggt cttcggcaag      2040
     gatctcggcg aaatggaaaa ggttgccagg gaaatcgaag ccgtcgtcaa agccgttccc      2100
     ggaacgacca gcgcctacgc cgaacgcatc accggcggct tctacctgaa catcgaaccg      2160
     gaccgcgaac agctggcgcg ctacggcctg gccgtcggcg acctgcagga cgtgatcggc      2220
     acggcgctcg gcggcgaaat ggtgacgacc acggtcgagg gccgcgaacg cttcggcgtc      2280
     agcgtgcgct atccgcgcga attgcgttcc gacccgcagc agatcgcccg cgaagtgctg      2340
     atcccgacca tggacggcgc gatgattccg ctcgggcaac tggccagggt gggcgtcgcc      2400
     aagggcgcgc cgtcgatccg caccgagaac gcgctgctct cagcctatat cttcgtcgac      2460
     atccgcgacc gcgacatcgg cagctacgtc gccgacgcca agaaggcggt cgccgaacag      2520
     gtcagcttcc cgcccggcta ctacgtcacc tggagcggcc agttcgagta catggaacgg      2580
     gctatcgaga agatgaaaat cgtcatcccg gtgacgctgc tgtcgatctt cctgctgctc      2640
     tacctcaact tcaagcgcct caccgaaacg ctgatcgtca tgctctcggt gccttttgcg      2700
     ctggtcggcg gcgtctggct gatgtggtgg ctcggctaca acctgtcggt cgccgtcgcc      2760
     gtgggcttca tcgccttggc cggggtcgcg gcggaaaccg gggtgatcat gctgatttat      2820
     ctcgatcatg cttgggaagc gttgaaagcc aaacgtcgga cggataatca ggccccaacg      2880
     ctgcacgatc tctacgaggc catcatggaa ggcgccgtgg aacgggttcg cccgaaaatg      2940
     atgacggtgg tggcaatcat ggcgggcctg ctgccaatca tgtggggcac ggggacaggc      3000
     tccgaagtca tgagccgcat tgcggcgccg atggtcggcg ggatgatctc gtcgacggtg      3060
     ctgacgctcg cggtcatccc agccatctac gctttggtca agcagtggcg aatcaaacgg      3120
     ggaatggagc aatga                                                       3135
//

If you have problems or comments...

PBIL Back to PBIL home page