(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE81

ACCPU_3.PE81         Location/Qualifiers
FT   CDS_pept        complement(93556..95184)
FT                   /locus_tag="CAP2UW1_4655"
FT                   /gene_family="HOG000126091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091586"
FT                   /db_xref="GeneID:8402021"
FT                   /translation="MNKGAGLTVGVIAVAMAAGSGYWLGGRGDASHGDAASVASASAEP
FT                   AKKEKKLLFYRNPMGLPDTSPVPKKDPMGMDYIAVYEGEQDDEPASANQIKISTEKVQK
FT                   LGVRTEAAQLRVLDKVVRAAGRIEPDERRIYAISPKFEGYVERLHVNVTGQPVGKGQPL
FT                   FEVYSPELVSAQREYAIAAQGVESLKEADGPARDGMKQLADSSLLRLKNWDISEEQVKA
FT                   LAKSGEARRTLTFRSPVSGIVTEKKALQGMRFMPGEALYQVADLSAVWVVADVFEQDIG
FT                   QVRTGAKAKVRINAYPDKTFEGTISYVYPTLNAQTRTVPVRVELANPGLLLKPSMFAQV
FT                   ELPVGAKGQVVTLPTSAVIDSGARQIVLIQQGEGRFEPREIKLGGRSDNHVEVLEGVKD
FT                   GEQVVVAANFLIDAESNLKAAVGGFGHAAHGAAPTDGKPAVPGQAAAKGSSHQAEGTVD
FT                   GIDAAAGTISLNHGPVASLKWPTMTMEFKAANASLLQGLKPGAKVAVEFVERQPGEWVI
FT                   TAVKPLPANQGAGTPAVGANPHAGH"
FT                   /protein_id="YP_003165229.1"
     atgaacaagg gtgcgggact gaccgtcggc gttattgcgg ttgccatggc agccggtagt        60
     ggttactggc tgggcggacg tggtgacgct tcccatggcg atgcagcatc ggtcgccagc       120
     gcctcagccg agccggccaa gaaagagaaa aagctgctct tctaccgcaa tccgatgggg       180
     ctgcccgaca cttcgcctgt gcccaagaaa gatccgatgg ggatggatta catcgcggtc       240
     tatgagggag agcaggatga cgaaccggca tctgccaacc agatcaagat cagtaccgag       300
     aaggtgcaga aactgggtgt gcggacggaa gccgcccaat tgcgcgtcct tgacaaggtg       360
     gtccgcgccg ccggtcgtat cgaaccggac gagcgccgta tctatgcgat ctctcccaag       420
     ttcgagggct acgtcgagcg cctgcacgtc aatgtcaccg gccagccggt cggcaagggg       480
     cagccgctgt tcgaggtcta cagcccggaa ctggtttccg cccagcgcga atacgcgatt       540
     gccgcccaag gcgtcgaatc gctgaaggaa gccgacggcc cagcgcggga tggcatgaag       600
     caactggccg attccagcct gttacgcctg aagaactggg atatttcgga ggagcaggtc       660
     aaggccttgg ccaagtccgg cgaagcgcgg cgcacgctga ctttccgctc gccggtttcc       720
     ggcatcgtca ccgagaagaa ggcgctacag ggcatgcgtt tcatgccggg cgaggcgctt       780
     taccaagtgg cagacctgtc ggccgtctgg gtggtcgccg acgtgtttga gcaggacatc       840
     ggccaggtca ggactggggc caaggccaag gtcaggatca acgcctaccc ggacaagacc       900
     ttcgaaggca cgatcagcta tgtctatccg accttgaacg cccagacgcg cacggtaccg       960
     gttcgcgtcg aactggccaa tccggggctg ctgctcaagc cgtcgatgtt cgcccaggtc      1020
     gaactgccgg tgggtgccaa aggccaggtt gtcacgctgc cgacctccgc cgtaatcgac      1080
     agcggtgccc gccagatcgt gctgatccag caaggcgaag gtcgcttcga gccacgcgaa      1140
     atcaagctcg gtggccgcag cgacaatcat gtcgaagtgc tggagggtgt caaagatggc      1200
     gagcaggtgg tggtcgctgc caacttcctg atcgatgccg agagcaacct caaggcagcg      1260
     gtcggcggtt tcggccacgc cgcccacggt gccgccccga cggacggaaa accggcagtg      1320
     cccggacagg cagccgccaa aggatccagc caccaggccg aaggtacggt ggatggcatt      1380
     gacgcggcag ccggcacgat cagtctcaat cacggcccgg tcgccagcct caaatggccg      1440
     accatgacca tggagttcaa ggccgccaac gcatcgctgc tgcaagggct gaaaccgggg      1500
     gccaaagtcg ccgtcgagtt cgtcgagcgg cagcccggcg aatgggtgat tacggccgtc      1560
     aagccgctgc cagcaaacca gggagccggc acgccggccg tcggcgccaa cccgcacgcc      1620
     ggtcactga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page