(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE82

ACCPU_3.PE82         Location/Qualifiers
FT   CDS_pept        complement(95181..96452)
FT                   /locus_tag="CAP2UW1_4656"
FT                   /gene_family="HOG000220103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091587"
FT                   /db_xref="GeneID:8402022"
FT                   /translation="MRRLRPLSILILALATASGAPVLAQEAALGANVDTLINYAKTRNP
FT                   EYAAMQAEAEASGERVTPAGALPDPKFRTELRDITRMGEQSATLSPSRVGSTRYLLMQD
FT                   IPWFGKRDLKREIAELEADGAKGRALGTWADVAGRIKVNFAQLYYVHRNEQLTREILDL
FT                   MTRLEKVAQVRYSGGLAAQQDVIRAQVEQTNMRNELIALETEQHHLHARLNALLARPNN
FT                   APLQVPTQLRKLPAPVTLDYATLEERVRTRNPQLFADESKIKAAEKSRDLTYKNRYPDF
FT                   TLGVSPIQYQNSIKEWELMFEVNIPLQQSSRRSQERESESMLNAARSRKEATTNQVSAE
FT                   LAEALSGIEAARRTENLLTNSLLPQAELTFKAALAGYETGKVDFATLLDSQRQIRQARQ
FT                   DQLKAQVDAQMRLAEIERLLGEDL"
FT                   /protein_id="YP_003165230.1"
     atgcgccgac tcaggccgtt atccattttg atcctggcgc ttgccaccgc ctctggcgcg        60
     cccgttcttg cccaggaggc cgccctcggt gcgaacgtcg acaccctgat caattacgcc       120
     aagacgcgca atccggagta cgccgcgatg caggccgagg ccgaagcatc gggcgagcgg       180
     gtgacgccag ctggtgcctt gcccgacccg aaattccgta ctgaattgcg cgacatcacc       240
     cggatgggcg aacaaagcgc aacgctttcc ccaagtcgcg tcggcagcac ccgttacctg       300
     ctgatgcagg acattccctg gtttggcaag cgcgacctga agcgcgagat tgcagagctt       360
     gaagccgacg gagccaaggg tcgtgcgctg ggcacctggg cagatgtggc cgggcggatc       420
     aaagtcaatt tcgcccagct ttattacgtg caccgcaatg agcaattgac ccgggaaatc       480
     ctcgacctga tgacccgcct ggaaaaagtc gcccaggtac gctattccgg cggcctggcg       540
     gcacagcagg atgtcatccg agcccaggtc gagcagacca acatgcgcaa cgagttgatt       600
     gccttggaaa ccgaacagca ccacctgcat gcccggctga acgccttgct ggcccgccca       660
     aacaatgcgc cgttgcaggt gccaacccag ttgcgcaagc tgccggcgcc ggtgacgctg       720
     gattacgcca cgctggaaga gcgcgtgcgc acccgcaacc cgcaactgtt cgccgacgaa       780
     tcgaaaatca aggctgccga gaaatctcgc gacctgacct acaaaaaccg ctatcccgac       840
     tttacgctgg gcgtatcccc catccagtac cagaactcca tcaaggaatg ggagttgatg       900
     ttcgaagtga atatcccgct gcaacagtct tcgcggcggt cgcaggagcg ggaatccgag       960
     tcgatgctca atgccgcccg ctcgcgcaag gaagccacca ccaaccaggt ctccgccgaa      1020
     ctggccgagg ccctgtccgg catcgaagcc gcccgtcgca cggaaaacct gctgacaaac      1080
     agtctgctgc cgcaggccga attgaccttc aaggcggcac tggccggcta cgagaccggc      1140
     aaggtggatt tcgccacgtt gctagattcc cagcgccaaa tccggcaggc cagacaagac      1200
     cagcttaagg ctcaagtcga cgcccagatg cgtctggccg aaatcgaacg tcttttaggg      1260
     gaagatctat ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page