(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE83

ACCPU_3.PE83         Location/Qualifiers
FT   CDS_pept        complement(96531..96875)
FT                   /locus_tag="CAP2UW1_4657"
FT                   /gene_family="HOG000126315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091588"
FT                   /db_xref="GeneID:8402023"
FT                   /translation="MKTLITASLMAIASLGAVSVQAAGNHAGHAMAAPAAASAEMQMVD
FT                   GQVKKVDKAAGKVTLSHGPLTNLNMPAMTMVFKVSNAAWLDQMKSGDKIRFMADTVKGA
FT                   ITVVHFEPTK"
FT                   /protein_id="YP_003165231.1"
     atgaaaacac tcatcaccgc ctccctgatg gccattgcat ctctcggagc cgtttcggtc        60
     caggctgcag gcaaccacgc cggccatgcc atggctgcac cggccgccgc gtccgctgaa       120
     atgcaaatgg tcgacggcca ggtcaaaaaa gtggacaagg ccgctggcaa ggtgaccttg       180
     tcgcacggcc cgttgaccaa cctgaacatg ccggcgatga ccatggtctt caaggtttca       240
     aatgccgcct ggttggacca aatgaagtcc ggcgataaga ttcgcttcat ggccgacacc       300
     gtgaaaggtg ccatcaccgt cgtccatttc gaaccaacca aatag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page