(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE84

ACCPU_3.PE84         Location/Qualifiers
FT   CDS_pept        complement(96894..97334)
FT                   /locus_tag="CAP2UW1_4658"
FT                   /gene_family="HOG000270297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091589"
FT                   /db_xref="GeneID:8402024"
FT                   /translation="MRNHVLVLALITAFGAGLSSVATAGEMVDVYKNPNCDCCGKWIDH
FT                   LKDAGFEVRAHNVMDVPATRKRLGMPDRLGSCHTAKVAGYVVEGHVPAGDIQRLLKEKP
FT                   KALGIAVPSMPPGSPGMESSKPVPYNTLLVQSGGEASIFAKH"
FT                   /protein_id="YP_003165232.1"
     atgcgtaacc acgtccttgt tctcgccttg atcacagcct tcggtgccgg cctttcctcc        60
     gtcgcaacgg caggcgaaat ggtcgatgtc tacaagaacc cgaactgcga ttgctgcggc       120
     aagtggattg accacctgaa ggacgcgggc ttcgaggttc gcgcgcacaa tgtcatggac       180
     gtcccggcaa cccggaagcg actggggatg ccagaccgcc tcggctcctg ccataccgcc       240
     aaggtagccg gttatgtggt cgagggccat gtgcctgctg gcgacatcca gcgcctgctc       300
     aaggaaaagc cgaaagccct tggcatcgcg gtgccttcga tgccccccgg ttcgccaggc       360
     atggaaagtt cgaaacccgt tccctacaac acgctgctgg tccagtccgg cggtgaagcc       420
     agcatctttg ccaaacattg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page