(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE86

ACCPU_3.PE86         Location/Qualifiers
FT   CDS_pept        97858..98391
FT                   /locus_tag="CAP2UW1_4660"
FT                   /gene_family="HOG000158229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091591"
FT                   /db_xref="GeneID:8402026"
FT                   /translation="MQRIVAGISTLEQHLETVKGKREVYRPPSCPHCGIKLLCQHGYYY
FT                   RKADRRVQRPSLNPVPICRYRCGGCRRTCSRLPECIAPRRWYDWSVQQNALSARLDGRP
FT                   VGGGGDDGQPAVRSTGRWWAWLQARGPIFAFSLRCRFRELGRASDFTGFWRQVFATLGL
FT                   PRAMAWLDREMSVP"
FT                   /protein_id="YP_003165234.1"
     ATGCAACGAA TTGTAGCCGG CATCAGCACG CTTGAGCAGC ACCTGGAGAC GGTGAAGGGG        60
     AAGCGCGAGG TCTATCGACC GCCGTCGTGT CCGCACTGCG GAATCAAGCT CCTGTGTCAG       120
     CACGGGTACT ACTACCGGAA GGCCGATCGG CGAGTGCAGC GGCCCTCGCT CAACCCGGTG       180
     CCGATCTGCC GTTACCGCTG TGGCGGTTGC CGGCGCACCT GTTCGCGCCT CCCCGAGTGC       240
     ATTGCCCCAC GGCGTTGGTA CGACTGGTCG GTGCAACAGA ACGCCCTGTC GGCTCGACTC       300
     GACGGCCGGC CTGTCGGCGG CGGTGGCGAC GACGGACAGC CTGCCGTGCG CAGTACCGGT       360
     CGCTGGTGGG CCTGGCTCCA GGCTCGCGGA CCGATCTTCG CGTTTTCTCT GCGTTGCCGC       420
     TTTCGCGAGC TGGGTCGGGC GAGTGACTTC ACGGGGTTCT GGCGCCAGGT GTTCGCCACG       480
     CTCGGCCTGC CACGAGCCAT GGCCTGGCTG GACCGGGAGA TGAGCGTCCC ATGA             534
//

If you have problems or comments...

PBIL Back to PBIL home page