(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE87

ACCPU_3.PE87         Location/Qualifiers
FT   CDS_pept        98521..99846
FT                   /locus_tag="CAP2UW1_4661"
FT                   /gene_family="HOG000220570" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091592"
FT                   /db_xref="GeneID:8402027"
FT                   /translation="MNEIDPQALFRFSVLGPLISRQRLARGELQKSLRELATREYVIPG
FT                   TDRRLLGEKTIEGWYYRYRARGLDGLIPKVRADRGQSKLSASVQAAILAAKRENPRRSI
FT                   RQIQRVLEIGGIVARGTLSRSSLHRLLQQHGLSRLPGSASLPEEKRSFVAACAGELWYS
FT                   DVMHGPRVPIGGRLGKSYLVSLFDDASRLVAHGAFCRGETALDIEGVLKQALLKRGVPV
FT                   KLVVDNGAAYVAQTLQGICARLGIVLVHCRPYAPESKGKIERWHRTCRDQFLSEVEERH
FT                   VLSLDDLNARLWAWLEQVYHRTPHDGLEGQTPLARYQQDLPKIRLLGPLAATLDTLFLH
FT                   RVRRLVRKDGTVSYQGGRFEVPFELTGKTVCLRVDPHTETVVGVENDAGELIGRATPLD
FT                   ALANRDRRRRQPDPVAAVPVKRPAGPNLVELVYEQYYGRQGD"
FT                   /protein_id="YP_003165235.1"
     ATGAACGAAA TCGATCCGCA AGCCCTGTTT CGCTTCTCCG TCCTGGGTCC GCTGATCAGT        60
     CGGCAGCGGC TGGCGCGGGG TGAGCTGCAA AAGAGCCTGC GTGAGCTGGC AACGCGCGAG       120
     TACGTCATCC CCGGCACCGA TCGGCGCTTG CTCGGCGAGA AGACGATCGA GGGGTGGTAC       180
     TACCGCTACC GCGCGCGCGG CCTCGATGGG CTGATCCCGA AGGTGCGTGC CGATCGCGGC       240
     CAGTCGAAAC TGTCGGCGTC CGTCCAGGCG GCTATTCTCG CCGCCAAGCG CGAGAATCCC       300
     CGGCGCTCGA TTCGCCAGAT CCAGCGCGTG CTCGAGATCG GCGGCATCGT CGCGCGGGGC       360
     ACCCTGTCGC GCTCGAGTCT CCACCGCCTG CTCCAGCAAC ACGGTCTGTC GCGGCTCCCC       420
     GGCTCGGCGA GCCTGCCCGA GGAGAAACGC AGCTTCGTCG CCGCCTGCGC CGGTGAGCTC       480
     TGGTACAGCG ACGTGATGCA CGGCCCACGC GTGCCGATCG GCGGTCGTTT GGGCAAGAGC       540
     TATCTGGTGT CGCTCTTCGA CGACGCGTCC CGGCTCGTCG CTCACGGCGC CTTCTGCCGC       600
     GGCGAGACGG CGCTGGACAT TGAAGGCGTC CTCAAGCAGG CGCTCCTCAA ACGGGGCGTA       660
     CCGGTCAAGC TAGTCGTCGA TAACGGTGCC GCCTATGTCG CGCAGACGCT ACAGGGGATC       720
     TGCGCGCGTT TGGGCATCGT CCTGGTCCAT TGTCGGCCCT ACGCGCCCGA GAGCAAGGGG       780
     AAGATCGAGC GCTGGCACCG GACCTGCCGC GATCAGTTTC TCAGCGAGGT CGAGGAACGC       840
     CATGTCCTGA GTCTGGACGA TCTCAACGCG CGGCTGTGGG CCTGGCTGGA GCAGGTCTAT       900
     CACCGCACCC CGCATGACGG CCTTGAGGGC CAGACGCCGC TCGCTCGGTA TCAGCAGGAT       960
     CTGCCGAAGA TCCGTTTGCT GGGGCCACTG GCGGCGACGC TCGATACGCT GTTCCTGCAC      1020
     CGCGTCCGCC GTTTGGTGCG CAAGGATGGC ACGGTGTCGT ATCAGGGCGG GCGCTTCGAG      1080
     GTGCCTTTCG AACTGACGGG CAAGACCGTT TGCCTGCGCG TCGATCCGCA CACCGAGACG      1140
     GTGGTCGGCG TCGAGAACGA CGCCGGCGAG TTGATCGGCC GGGCGACACC GCTCGATGCG      1200
     TTGGCCAATC GCGATCGGCG GCGACGTCAG CCGGACCCGG TGGCGGCCGT ACCGGTCAAG      1260
     CGCCCCGCTG GGCCGAATCT GGTCGAGCTG GTGTATGAGC AGTACTACGG CCGCCAAGGA      1320
     GACTGA                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page