(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE88

ACCPU_3.PE88         Location/Qualifiers
FT   CDS_pept        99849..100643
FT                   /locus_tag="CAP2UW1_4662"
FT                   /gene_family="HOG000158228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091593"
FT                   /db_xref="GeneID:8402028"
FT                   /translation="MELQHFGLRHSPLGKETRELWDDGMLTRLRERFQWLLQSPGIGLL
FT                   TGEAGVGKTAALRAVTATLNPHRYQVIYHAETDFGRLDLYRCLAQSLGLAPSYRRALLW
FT                   REIKAHIHHLADGKQLLPVWILDEAQNLPPDFFRDFPAFLNFAFDSRDLMSVWLVGHPV
FT                   LAQTLQRAPYAALAGRIQARVHLTPVFERERFARLIEHGLKSAGNSSTLLTDSGMEILR
FT                   QASKGLPRNAARILRTAMRLALPRGLNHLPDELLQLAIEELR"
FT                   /protein_id="YP_003165236.1"
     ATGGAACTGC AACACTTTGG GCTGCGCCAC TCGCCGTTGG GCAAGGAGAC CCGCGAGTTG        60
     TGGGACGACG GGATGCTCAC GCGCTTGCGC GAGCGCTTCC AGTGGTTGCT GCAATCGCCG       120
     GGGATCGGGC TGCTCACCGG CGAGGCGGGA GTGGGCAAGA CGGCAGCGCT GCGGGCGGTG       180
     ACGGCGACGC TCAATCCGCA TCGCTATCAG GTGATCTACC ACGCGGAGAC GGACTTCGGC       240
     CGCCTCGATC TGTATCGGTG CCTGGCGCAG TCGCTGGGCC TGGCACCGAG CTATCGGCGG       300
     GCGCTGTTGT GGCGGGAGAT CAAGGCGCAT ATCCACCATC TGGCGGATGG CAAGCAACTC       360
     CTGCCGGTGT GGATCCTCGA CGAGGCACAG AATCTGCCGC CGGACTTCTT CCGCGATTTC       420
     CCGGCCTTCC TCAACTTCGC TTTCGACTCG CGCGATCTGA TGAGTGTCTG GCTGGTCGGC       480
     CATCCGGTGC TCGCGCAGAC GCTGCAACGC GCCCCATATG CGGCGCTCGC CGGACGCATT       540
     CAGGCGCGCG TGCACTTGAC GCCGGTGTTC GAGCGCGAGC GCTTTGCGCG ACTGATCGAG       600
     CATGGGCTGA AGAGCGCCGG CAACTCGTCT ACGCTGCTCA CCGATTCCGG CATGGAGATC       660
     TTGCGCCAAG CGAGCAAGGG GCTGCCCCGG AATGCGGCGC GTATCCTGCG CACCGCCATG       720
     CGTCTGGCGC TGCCGCGCGG GCTCAATCAT CTGCCCGACG AACTGTTGCA ACTGGCCATC       780
     GAGGAACTCC GATGA                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page