(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE9

ACCPU_3.PE9          Location/Qualifiers
FT   CDS_pept        complement(8784..9083)
FT                   /locus_tag="CAP2UW1_4576"
FT                   /gene_family="HOG000118706" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091514"
FT                   /db_xref="GeneID:8401949"
FT                   /translation="MQTSDPVTDDKTRAARLEARLSVEQKAVLQQAATLSGRTLSEFVV
FT                   ASAQEAAARILREHETIRLSRAEQIAFVTALLDPPAPNERLRQAAAAYRQQMGR"
FT                   /protein_id="YP_003165157.1"
     atgcagacca gcgatccagt caccgacgac aagacgcgcg cggcgcgcct ggaagcccgc        60
     ctgtcggtcg aacaaaaagc ggtgctacaa caggctgcca cgctatccgg gcgcaccctg       120
     agcgaattcg tcgtcgccag cgcccaggag gctgccgcgc gcatccttcg ggaacacgaa       180
     acgatccgcc tgagccgggc cgagcagatc gcgttcgtga ccgctttgct cgacccgccc       240
     gcgccgaatg agcgtctgcg ccaggccgca gcggcctacc gccagcaaat ggggcggtga       300
//

If you have problems or comments...

PBIL Back to PBIL home page