(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE90

ACCPU_3.PE90         Location/Qualifiers
FT   CDS_pept        complement(100821..101867)
FT                   /locus_tag="CAP2UW1_4664"
FT                   /gene_family="HOG000002547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091595"
FT                   /db_xref="GeneID:8402030"
FT                   /translation="MKQISFSEAEFAAKRPVTRRERFLADRERVIPWQDVLAIIEPYYP
FT                   KGKRGRPPIGLERMLRVYLVQQCYGLSDEGVEDAITDSQALRGFVRIDLSREAVPDATT
FT                   LLQFRHLLEEKDLSKAIFAAINAQLTAKGLMMREGTIADATILAAPPSVKNEAKARDPE
FT                   MHQTKKGNQWHFGMKAHIGVDAESGLVHTVVGTAANAADVTQTAEVLHGEETTVYLDAG
FT                   YTGVEKREELKDRDIDWQVATKRSKLKAIPKESQLGPLLRRLESVKASIRSKVEHPFHI
FT                   VKNLFSHRKVRYKGLKKNTAQCYVPPYSGFFVPSYFGVRQAESPTLSPGGLAPATGWDK
FT                   GPIGIGER"
FT                   /protein_id="YP_003165238.1"
     gtgaagcaga tcagcttttc ggaagccgag tttgccgcga agaggccggt aaccagacgc        60
     gagcgctttc ttgccgacag ggaacgggtc atcccctggc aagacgtgct ggcgatcatc       120
     gaaccgtact acccgaaagg gaagcgcggc cggccgccga tcgggctgga gcgcatgctg       180
     cgggtgtacc tggtccagca atgctacggc ctgtcggacg agggggtaga ggatgcgatc       240
     accgacagcc aggcgttgcg gggattcgtg cggatcgatc tgtcgcgaga ggcggtgccg       300
     gatgcgacga cgctgctgca gtttcgccac ttgctggaag agaaggacct gtcgaaggcc       360
     atcttcgcgg cgatcaacgc gcaactgacg gccaaggggc tgatgatgcg cgagggaacg       420
     attgccgatg cgacgatcct tgccgcaccg ccgtcggtga agaacgaagc gaaggcccgc       480
     gatccggaga tgcaccagac gaagaagggc aaccagtggc acttcggcat gaaagcgcac       540
     atcggggtcg atgccgagag cgggctggtg catacggtgg tcggaacggc ggcgaacgcc       600
     gccgacgtga cgcagaccgc cgaagtgctg cacggcgaag agacgaccgt gtatctggat       660
     gccggttaca ccggtgtcga gaagcgcgaa gagttgaaag accgggacat cgactggcag       720
     gtggcgacca agcgcagcaa gctgaaggcg atcccgaagg agagccagct tggcccactg       780
     ctgcggcgcc tggaatcggt caaggcgagc atccgctcga aggtcgagca cccctttcac       840
     atcgtgaaga acctcttcag ccatcgcaag gtccgctaca agggactgaa gaagaacacg       900
     gcccagtgtt acgtcccgcc ctattctgga ttctttgtcc cgagctattt cggggtgaga       960
     caagccgaaa gtcccacgct gtcgccggga ggactggctc cggcgacagg gtgggacaag      1020
     gggcctatcg ggatcgggga gcgttag                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page