(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE92

ACCPU_3.PE92         Location/Qualifiers
FT   CDS_pept        102678..102965
FT                   /locus_tag="CAP2UW1_4666"
FT                   /gene_family="HOG000229130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091597"
FT                   /db_xref="GeneID:8402032"
FT                   /translation="MMKKMLMVALMSAVSVTAFASDAARAAAKQVIELKDGSTVYIFKD
FT                   GKMGMEDKLGRSIRMKKDTVMETKDGQKIIMHGDEVMRLDNLLKEGHTGG"
FT                   /protein_id="YP_003165240.1"
     ATGATGAAAA AAATGCTGAT GGTTGCCCTG ATGAGCGCGG TCTCGGTGAC CGCATTCGCA        60
     TCCGATGCCG CTCGTGCTGC TGCAAAGCAA GTGATTGAGC TGAAGGATGG CTCGACGGTC       120
     TACATTTTCA AGGATGGGAA AATGGGCATG GAGGACAAAC TCGGTCGTTC GATTCGCATG       180
     AAGAAAGACA CCGTGATGGA AACCAAGGAT GGTCAGAAGA TCATCATGCA CGGCGACGAA       240
     GTCATGCGCC TCGACAACCT GTTGAAGGAA GGTCATACGG GCGGTTGA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page