(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE93

ACCPU_3.PE93         Location/Qualifiers
FT   CDS_pept        complement(102975..103160)
FT                   /locus_tag="CAP2UW1_4667"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091598"
FT                   /db_xref="GeneID:8402033"
FT                   /translation="MERETGQHFDPAIYAVFRQIALRLYEQGQSRDHAQWILELKVMLE
FT                   RCLKMKTAPEGAAAFT"
FT                   /protein_id="YP_003165241.1"
     atggaacggg aaacaggcca gcatttcgac ccggcgatct atgccgtctt ccgacagatt        60
     gctctgaggc tatacgagca aggccagtcc agagatcacg cccaatggat actggaattg       120
     aaggtgatgc ttgaacggtg cctcaaaatg aaaacggccc ccgaaggagc cgctgcattc       180
     acgtga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page