(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE95

ACCPU_3.PE95         Location/Qualifiers
FT   CDS_pept        104919..105173
FT                   /locus_tag="CAP2UW1_4669"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091600"
FT                   /db_xref="GeneID:8402035"
FT                   /translation="MNDYVSAVVSERLASRGHATVSARVDRRREATLNFAIGAAVAQRR
FT                   GIVPGASVPLRLQKPAIRLLPGDVAIAGQAGTSGKGQSP"
FT                   /protein_id="YP_003165243.1"
     GTGAACGATT ACGTCAGCGC GGTCGTCAGC GAGCGCCTCG CCTCGCGCGG ACACGCCACC        60
     GTCAGCGCCC GCGTCGACCG CCGCCGCGAG GCGACACTGA ACTTCGCCAT CGGCGCCGCC       120
     GTCGCGCAGC GGCGGGGAAT CGTCCCCGGC GCCAGTGTGC CGCTGCGACT GCAGAAGCCA       180
     GCGATCCGCC TGCTGCCCGG CGATGTGGCG ATTGCCGGAC AGGCGGGAAC TTCCGGCAAG       240
     GGGCAATCCC CATGA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page