(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE96

ACCPU_3.PE96         Location/Qualifiers
FT   CDS_pept        complement(105494..105754)
FT                   /locus_tag="CAP2UW1_4670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091601"
FT                   /db_xref="GeneID:8402036"
FT                   /translation="MLLRSGDRPDQQVTAFRANIGETVLAGLHEHFPRIERSTTSSMQY
FT                   DKTLAQFRRRPEPPGQMLGWVCRGDPSYLDLANDRMELVPH"
FT                   /protein_id="YP_003165244.1"
     gtgctacttc gttctggcga tcggcccgac cagcaggtaa ccgccttccg cgccaacatc        60
     ggcgagacgg tgctggccgg tctgcacgag cacttcccgc gcatcgagcg ctcgaccacc       120
     agcagcatgc aatacgacaa gacgctcgcg caattccgtc ggcggccgga accgccaggc       180
     cagatgctgg ggtgggtctg ccgcggtgac ccgtcctacc tcgacctggc aaacgaccgg       240
     atggaactgg tgccgcactg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page