(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE97

ACCPU_3.PE97         Location/Qualifiers
FT   CDS_pept        105944..107302
FT                   /locus_tag="CAP2UW1_4671"
FT                   /gene_family="HOG000013931" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091602"
FT                   /db_xref="GeneID:8402037"
FT                   /translation="MSHFIVTDRKTDYLLPPSLDDWLNQDHLARFIVEVVDQLDLSKLT
FT                   RQYAGRGSKAYHPATLLAILVYGYATGIFSSRRLERATYDSVAFRYIAAGSHPDHDSLA
FT                   TFRRRFLDELSDLFLQVLAMAKEMKLLKLGNVCLDGTKIDANASRHSALSHGHIEKLEA
FT                   QLKAEVQELFSLAEQADQADVPDGVSLPEEIKRREDRLAAMAVAKAKIAARAEERYQRE
FT                   KADYDEKMARRAAKEEAAGKKLGGKPPKAPEPGARDSDQINLTDEESRIMPVAGGGFEQ
FT                   AYNAQAGVDAATMLVVAVGVTQAPNDKEQVEPMLATLKAQAEVLGPVESLIADSGFCSE
FT                   KNIKACEAASIDPVIAVARDEHHPDWRERHSEPAPLPENATPVQALSHRLKTKAGRALY
FT                   ALRKQTVEPVFGIIKSVMGFRQFSLRGLKKVTGEWTLVCLAWNLKRMAKLRPQ"
FT                   /protein_id="YP_003165245.1"
     ATGTCCCACT TCATCGTCAC CGACCGTAAG ACCGACTACC TGCTACCGCC GTCACTGGAC        60
     GATTGGCTGA ACCAGGATCA CCTGGCGCGA TTCATCGTGG AGGTAGTCGA CCAGCTGGAC       120
     CTGTCGAAGC TGACGCGACA GTACGCTGGA CGTGGATCGA AGGCGTACCA TCCGGCGACC       180
     CTGCTGGCAA TTCTGGTCTA TGGCTACGCC ACGGGTATTT TCTCCAGCCG CAGGCTGGAG       240
     CGGGCAACCT ACGATTCGGT AGCCTTCCGC TACATTGCCG CCGGAAGCCA TCCCGATCAC       300
     GACAGCCTGG CGACGTTCCG CCGGCGTTTT CTGGACGAAC TGAGCGACCT GTTTCTGCAG       360
     GTCCTGGCGA TGGCCAAGGA AATGAAGCTG CTCAAGCTAG GTAACGTCTG TCTTGACGGC       420
     ACGAAGATCG ACGCCAACGC CTCAAGGCAC AGCGCGCTCT CCCACGGACA CATCGAAAAG       480
     CTGGAAGCCC AGCTCAAGGC TGAGGTGCAG GAACTCTTCA GCTTGGCGGA ACAGGCGGAT       540
     CAAGCCGACG TTCCGGACGG CGTCAGCCTG CCCGAAGAAA TCAAGCGTCG TGAAGATCGG       600
     CTGGCGGCGA TGGCAGTGGC CAAGGCGAAG ATTGCTGCCC GGGCCGAAGA GCGTTATCAG       660
     CGAGAGAAAG CCGATTACGA CGAGAAAATG GCGCGGCGCG CGGCCAAGGA AGAAGCGGCC       720
     GGCAAGAAGT TGGGCGGCAA GCCGCCGAAA GCCCCCGAGC CCGGCGCACG GGACAGTGAC       780
     CAGATCAATC TGACCGACGA AGAATCGCGC ATCATGCCGG TGGCCGGTGG CGGCTTCGAA       840
     CAAGCGTACA ACGCCCAGGC CGGGGTTGAT GCGGCGACGA TGCTGGTTGT GGCGGTCGGC       900
     GTGACGCAAG CCCCCAATGA CAAAGAGCAG GTCGAGCCGA TGCTGGCGAC GCTCAAGGCA       960
     CAAGCCGAGG TGCTGGGTCC CGTGGAAAGT TTGATCGCCG ACAGTGGCTT CTGCAGCGAG      1020
     AAGAACATCA AGGCATGCGA GGCCGCCAGT ATCGATCCGG TGATCGCGGT GGCTCGCGAC      1080
     GAGCACCACC CTGACTGGCG GGAGCGGCAC AGCGAACCGG CGCCGCTGCC GGAGAATGCG      1140
     ACACCCGTGC AGGCCCTGTC GCATCGCTTG AAGACCAAAG CGGGACGAGC CCTCTATGCC      1200
     TTGCGCAAGC AGACCGTCGA GCCGGTCTTC GGTATCATCA AATCGGTCAT GGGCTTTCGC      1260
     CAGTTCTCGC TGCGCGGTTT GAAGAAGGTC ACGGGCGAGT GGACGCTGGT CTGCCTGGCG      1320
     TGGAACTTGA AGCGCATGGC CAAATTGCGC CCACAGTAG                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page