(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE98

ACCPU_3.PE98         Location/Qualifiers
FT   CDS_pept        complement(108857..109732)
FT                   /locus_tag="CAP2UW1_4674"
FT                   /gene_family="HOG000263697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091603"
FT                   /db_xref="GeneID:8402105"
FT                   /translation="MSSNKLTRATQEPAWVRYTLLTVGLGFLFFFLGLPLVAVFVEALA
FT                   QGLPIYLEALKESETRSAIWLTIVIALAVLPFNILFGVAAAWAIAKFEFKGKSLLITLI
FT                   DLPFAVSPVVAGLIFILMFGSQGYFGGLLAAKDVKIIFAVPGMILATLFITFPFIAREL
FT                   IPLMQSQGKDEEEAAISLGASGWQMFWRVTLPNIKWGLLYGVILSNARAMGEFGAVSVV
FT                   SGHIRGETNTLPLHVEILYNEYNAIGAFAAASVLALLALVTLVAKTIVEWRMKAETDML
FT                   NAELPGEKTS"
FT                   /protein_id="YP_003165246.1"
     atgagtagca acaaactgac acgcgccacg caggaaccgg cctgggtgcg ttacacgctg        60
     ctgacggttg gcctcggctt cctgttcttc ttcctcgggt tgccgctggt cgcggttttc       120
     gtcgaagcgc tggcgcaggg cctgccgatc tatcttgagg cgctgaagga atcggaaacc       180
     cgttcggcga tctggctgac catcgtcatt gcgctggccg tgctgccctt caacatcctg       240
     ttcggcgtcg ctgcggcctg ggccatcgcc aagttcgagt tcaagggcaa gagcctgctg       300
     atcacgctga tcgacctgcc cttcgcggtg tcgccggtgg tcgccggcct gatcttcatc       360
     ctcatgttcg gctcgcaggg ctatttcggc gggttgctgg cggccaagga cgtcaagatc       420
     atcttcgccg tgccgggcat gattctcgcc accctgttca tcaccttccc cttcatcgcc       480
     cgcgagctga tcccgctgat gcagtcgcag ggcaaggacg aggaagaggc ggcaatctcg       540
     ctcggcgcct ccggctggca gatgttctgg cgcgtcaccc tgcccaatat caagtggggc       600
     ctgctctacg gcgtgatcct gtcgaacgcc cgggcgatgg gcgaattcgg cgcggtgtcg       660
     gtggtttccg gccacatccg cggcgagacc aacacgctgc cgctgcacgt cgagatcctc       720
     tacaacgaat acaacgcgat cggcgccttc gccgccgcct ccgtgctggc cctgctggca       780
     ctggtgacgc tggtggccaa gaccatcgtc gaatggcgca tgaaggccga gaccgacatg       840
     ctgaacgctg aactccccgg cgagaaaact tcatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page