(data stored in ACNUC30567 zone)

HOGENOMDNA: ACCPU_3.PE99

ACCPU_3.PE99         Location/Qualifiers
FT   CDS_pept        complement(109729..110604)
FT                   /locus_tag="CAP2UW1_4675"
FT                   /gene_family="HOG000263698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091604"
FT                   /db_xref="GeneID:8402039"
FT                   /translation="MSAKSQRVLPGFGLALGYTLVYLSLLILLPLGGMILKASELGFGQ
FT                   ILDIALGERSLAAFRVTFVSSLLAASINAFFGLIVAWILVRYSFPGKRFVDALVDLPFA
FT                   LPTAVAGITLATLYAGNGWLGQYLEPLGVKVAYTPLGIIVALTFITLPFVVRTLQPVIE
FT                   DIETEVEEAAASLGASRWQTFVKAIFPAIGPALLTGFALAFARALGEFGSVIFIAGNLP
FT                   LISEIVPLLIISKLEQYDVLGATALAVVMLAISFVLLLVINALQWWAANRHKNSEPLEV
FT                   AAGKTKAGAA"
FT                   /protein_id="YP_003165247.1"
     atgtccgcaa aatcccaacg cgtgttgcct ggcttcggtc tggcgctggg ctatacgctg        60
     gtctatctct cgttactgat cctgctgccc ctcggcggca tgatactcaa ggcgtccgaa       120
     ctcggtttcg gccagattct cgacatcgcg ctcggcgaac gctcgctggc ggcctttcgt       180
     gtcaccttcg tgtcgtcgtt gctggccgcg tcgatcaatg ccttcttcgg gctgatcgta       240
     gcctggatcc tcgttcgcta ttcttttccc ggcaagcgct tcgtcgatgc gctggtcgat       300
     ctgccattcg cgctgccgac agcggtggcc ggcatcacgc tggccacgct ttacgccggc       360
     aacggctggt tggggcagta ccttgagcca ctgggggtca aggtggccta tacgccgctc       420
     ggcatcatcg tcgccctgac cttcattacc ctgcccttcg tcgtccgcac cttgcagccg       480
     gtgatcgagg atatcgaaac cgaagtcgag gaggcagccg cctcgctcgg cgcctcgcgc       540
     tggcagacct tcgtaaaagc gattttcccg gccatcggcc cggccttgct caccggcttc       600
     gcgctggcct ttgcccgggc gctcggcgaa ttcggctcgg tcatcttcat cgccggcaac       660
     ctgccgctga tttccgaaat cgtgccgctg ctgatcatct ccaagctgga gcagtacgac       720
     gtgctcggcg ccacggcgct ggccgtggtc atgctggcca tttccttcgt gctgctgctg       780
     gtcatcaatg cgctgcaatg gtgggcagcc aatcggcaca aaaacagtga gccgctggaa       840
     gtggctgccg gcaagaccaa ggcgggtgcg gcatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page