(data stored in ACNUC8465 zone)

HOGENOMDNA: ACCPU_4

ID   ACCPU_4; SV 1; empty ; DNA; empty ; PRO; 5058518 BP.
XX
AC   NC_013194;
XX
PR   Project: 59207;
XX
DE   Candidatus Accumulibacter phosphatis clade IIA str. UW-1, complete genome.
XX
OS   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Candidatus Accumulibacter.
XX
RN   [1]
RP   1-5058518
RG   US DOE Joint Genome Institute
RA   Martin,H.G., Ivanova,N., Kunin,V., Warnecke,F., Barry,K., He,S.,
RA   Salamov,A., Szeto,E., Dalin,E., Pangilinan,J.L., Lapidus,A., Lowry,S.,
RA   Kyrpides,N.C., McMahon,K.D. and Hugenholtz,P.;
RT   "Complete sequence of chromosome of Candidatus Accumulibacter phosphatis
RT   clade IIA str. UW-1";
RL   Unpublished
XX
RN   [2]
RP   1-5058518
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (01-SEP-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-5058518
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Barry,K., Pitluck,S., Lowry,S., Larimer,F., Land,M., Hauser,L.,
RA   Kyrpides,N., Ivanova,N., McMahon,K.D. and Hugenholtz,P.;
RT   "Direct Submission";
RL   Submitted (27-AUG-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001715.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3635729
CC   Source DNA available from Katherine D. McMahon
CC   (tmcmahon@cae.wisc.edu)
CC   Contacts: Katherine D. McMahon (tmcmahon@cae.wisc.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Candidatus Accumulibacter phosphatis Type
CC   IIA UW-1
CC   GOLD Stamp ID         :: Gi03328
CC   Isolation Site        :: enhanced biological phosphorus removal
CC   (EBPR) wastewater treatment bioreactor
CC   Collection Date       :: 6/30/2004
CC   Isolation Country     :: USA
CC   Latitude              :: 43.078418
CC   Longitude             :: -89.386482
CC   Altitude              :: elevation: 263m
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Sediment, Sludge
CC   Phenotypes            :: EBPR, Polyphosphate-accumulating
CC   Energy Source         :: Chemoheterotroph
CC   ##Metadata-END##
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..5058518
FT                   /strain="UW-1"
FT                   /mol_type="genomic DNA"
FT                   /organism="Candidatus Accumulibacter phosphatis clade IIA
FT                   str. UW-1"
FT                   /db_xref="taxon:522306"
FT   gene            239..1660
FT                   /db_xref="GeneID:8406656"
FT                   /locus_tag="CAP2UW1_0001"
FT   CDS_pept        239..1660
FT                   /locus_tag="CAP2UW1_0001"
FT                   /gene_family="HOG000235659" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="GI:257091664"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:8406656"
FT                   /translation="MSSFWSSCLSQFEQELPPQQFNTWIRPLRLEGEEDFARGLRLLAP
FT                   NGFILKWVKERYLARIEELGSEYFAAPVGITLTLGGRAAPPKDLAPDSPSKDSPSGDGK
FT                   TAAKVNAVNRHTSLLKNGSLVDRDRPSYEKTRLIPTFTFENLIVGKANDLARAASRQVA
FT                   ISPGEATYNPLFIYGGAGLGKTHLIHAIGNHILECFPDRIVRYVHAEDYYSDVVRAYQQ
FT                   KSFDVFKRYYRSLDVLLLDDVHFFNGKNRTQEEFFFVFNALSEAKKQLVISSDTYPKNI
FT                   SGLEDRLVTRFDWGLTVQIEPPETEMRVAILKKKAELEGVLLDDEVAFYVAKHLRSNVR
FT                   ELEGALKKVLAYSAFHGREIALDLAKEALKDVIGSVNRQITVDNIQKTVADYFKIKVAD
FT                   LFSKKRTRVIVRPRQIAMWLTKNLTSQSYPSIGEAFGGRDHTTVLHAVRTIDDLRAKDN
FT                   ELNHDVHVLLQVLKG"
FT                   /protein_id="YP_003165305.1"
FT   misc_feature    239..1657
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:178902"
FT                   /locus_tag="CAP2UW1_0001"
FT   misc_feature    686..1126
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0001"
FT   misc_feature    770..793
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0001"
FT   misc_feature    order(773..796,959..961,1055..1057)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0001"
FT   misc_feature    947..964
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0001"
FT   misc_feature    <986..1348
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="CAP2UW1_0001"
FT   misc_feature    1097..1099
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0001"
FT   misc_feature    1382..1651
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="CAP2UW1_0001"
FT   misc_feature    order(1451..1453,1475..1480,1499..1501,1517..1525,
FT                   1550..1564,1571..1573,1580..1585)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="CAP2UW1_0001"
FT   gene            1869..2999
FT                   /db_xref="GeneID:8402125"
FT                   /locus_tag="CAP2UW1_0002"
FT   CDS_pept        1869..2999
FT                   /locus_tag="CAP2UW1_0002"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dar:Daro_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="GI:257091665"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:8402125"
FT                   /translation="MLLIKTRRDTLLGPLQAVSGIVERRHTLPILSNVLLEKRGDVLTL
FT                   LATDIEIQITTWSTGAVGEGDGAVTVGARKLQEILRSLPESADVSLILDDKRLQLTAGK
FT                   SRFSLQTLPADDFPCMALSEGETKKFTVSQKQFRHLLAQTQYSMAAQDVRYYLNGLLLI
FT                   VDGSELRAVATDGHRLAYSSMPLDDAAQAPREPGAARQELIVPRKTVLELSRLLTDTDE
FT                   PLSIEMLATQIRFQFGHVSLVSKLIDGRFPDYERVIPATLRNVVSVSRGLLLQSMIRAA
FT                   ILTNEKFRGVRLILSAGSLKIMAANAEQEEAQEEIEVEYNGEPLDVGFNVAYLLDVLNN
FT                   TVDDTIEWGFNDANSSALLTIPGNDRFKYVVMPMRI"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165306.1"
FT   misc_feature    1878..2996
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:180180"
FT                   /locus_tag="CAP2UW1_0002"
FT   misc_feature    1878..2993
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="CAP2UW1_0002"
FT   misc_feature    order(1941..1943,2088..2090,2109..2111,2490..2492)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="CAP2UW1_0002"
FT   misc_feature    order(2091..2093,2100..2102,2178..2180,2184..2186,
FT                   2712..2714,2805..2810)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="CAP2UW1_0002"
FT   misc_feature    order(2388..2390,2394..2405,2856..2858,2982..2993)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="CAP2UW1_0002"
FT   misc_feature    order(2388..2390,2394..2399,2637..2639,2742..2744,
FT                   2781..2786,2865..2867,2982..2993)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="CAP2UW1_0002"
FT   gene            3062..5530
FT                   /db_xref="GeneID:8402126"
FT                   /locus_tag="CAP2UW1_0003"
FT   CDS_pept        3062..5530
FT                   /locus_tag="CAP2UW1_0003"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA gyrase, B subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: azo:azo0003 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="GI:257091666"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR011558"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="GeneID:8402126"
FT                   /translation="MIEENEESAYDESSIQQLEGLEAVRKRPGMYIGDTSDGTGLHHMV
FT                   FEVVDNAIDEALAGHCDEIVITIHADNSISVTDNGRGIPTGIKFDDKHEPRRSAAEIVM
FT                   CVLHAGGKFNQNSYKVSGGLHGVGVSCVNALSRWLRLIIRREGKKYLLEFNRGTVVDRL
FT                   LEVQKGVEVSPLRVVAATEKRGTELHFMADEEIFGQIEFHYEIIAKRLRELSFLNNGVK
FT                   IRLNDQRTGKEEDFAFLGGVRGFVEYINRTKSVLHPNIFYASGDSAGGNGVISVEVAMQ
FT                   WNDSYAEQVLCFTNNIPQADGGTHMTGLRAAMTRVINRYIEENEIAKKAKVDITGDDMR
FT                   EGLACVLSVKMPDPKFASQTKMKLVSSEARPAVEEVVAAKLSEYLQERPVDAKVITGKI
FT                   IEAARARDAARKAREMTRRKGLLDGVGLPGKLADCQEKDPALCELYLVEGDSAGGSAKQ
FT                   GRDRKFQAILPLKGKILNVEKARFDKLISSQEIATLITALGTGIGKDEYKPEKLRYHRL
FT                   IIMTDADVDGAHIRTLLLTFFYRQMPELVESGHIYIAQPPLYKVKHGKTERYIKDDQAL
FT                   KQFLLTLALEGAVLIPVAGAPEISGSTLEQLARQYLLAEAVINRLSHLINPEVLHALID
FT                   ANLAIDLADEASAMASADALMKAVGSKLDINIVARFDTAQERWQLRLEKILHGNLKLGV
FT                   IDDDLLVSGDYAQLRKTAEMLAGLFGPGGVVVRAEKKQAVSSFAETMQWLLSEVERSVS
FT                   KQRYKGLGEMNPEQLWETTMDPKVRRLLKVQIEDAIGADEIFTTLMGELVEPRRNFIET
FT                   NALAARNIDV"
FT                   /protein_id="YP_003165307.1"
FT   misc_feature    3071..5527
FT                   /note="DNA gyrase subunit B; Provisional; Region: gyrB;
FT                   PRK14939"
FT                   /db_xref="CDD:184903"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    3182..>3472
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    order(3200..3202,3212..3214,3221..3223,3287..3289,
FT                   3293..3295,3299..3301,3305..3310,3437..3448)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    3212..3214
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    order(3299..3301,3305..3307,3437..3439,3443..3445)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    3779..4264
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    3944..3946
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    order(4118..4120,4127..4132,4136..4138)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    order(4136..4138,4142..4144)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    4385..4729
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    order(4403..4408,4415..4417,4625..4627,4631..4633,
FT                   4637..4639)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    order(4403..4405,4625..4627)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="CAP2UW1_0003"
FT   misc_feature    5324..5494
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="CAP2UW1_0003"
FT   gene            complement(5543..6364)
FT                   /db_xref="GeneID:8402127"
FT                   /locus_tag="CAP2UW1_0004"
FT   CDS_pept        complement(5543..6364)
FT                   /locus_tag="CAP2UW1_0004"
FT                   /gene_family="HOG000245747" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; KEGG: azo:azo3659
FT                   orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="GI:257091667"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="GeneID:8402127"
FT                   /translation="MNFIHALRAAWRGRNSLLCVGLDPDPARFPAHLQQSPNAILDFCR
FT                   TIVDATADLVCCFKPQIAYFAAHRAEDQLEALIDHIHQRHPATPVILDAKRGDIGSTAE
FT                   QYAIEAFERFKADAITVNPYLGRDSVEPYLAYQDKGIILLCRTSNPGGNDLQFLDVGGE
FT                   KLYERVARLVNEEWNQNGQCALVVGATYPNEIARVRGLTGEMPLLVPGIGAQGGDIEST
FT                   VRAGCTSAGYGLMINSSRAILYAGSGEDYADAARRVALATRADINRYRPLV"
FT                   /protein_id="YP_003165308.1"
FT   misc_feature    complement(5591..6313)
FT                   /note="Orotidine 5'-phosphate decarboxylase (ODCase) is a
FT                   dimeric enzyme that decarboxylates orotidine
FT                   5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP),
FT                   an essential step in the pyrimidine biosynthetic pathway.
FT                   In mammals, UMP synthase contains two...; Region:
FT                   OMP_decarboxylase_like; cd04725"
FT                   /db_xref="CDD:73387"
FT                   /locus_tag="CAP2UW1_0004"
FT   misc_feature    complement(order(5645..5650,5735..5737,5921..5926,
FT                   6080..6082,6086..6088,6182..6184,6188..6190,6296..6298,
FT                   6302..6304))
FT                   /note="active site"
FT                   /db_xref="CDD:73387"
FT                   /locus_tag="CAP2UW1_0004"
FT   misc_feature    complement(order(5645..5647,5870..5872,5924..5926,
FT                   5960..5962,5993..6001,6047..6052,6059..6064,6071..6076,
FT                   6080..6085,6173..6178,6182..6184))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:73387"
FT                   /locus_tag="CAP2UW1_0004"
FT   gene            6533..7168
FT                   /db_xref="GeneID:8402128"
FT                   /locus_tag="CAP2UW1_0005"
FT   CDS_pept        6533..7168
FT                   /locus_tag="CAP2UW1_0005"
FT                   /gene_family="HOG000220211" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: azo:azo3573 hypothetical protein"
FT                   /db_xref="GI:257091668"
FT                   /db_xref="GeneID:8402128"
FT                   /translation="MLSRRGDSVKKLDNDAFVNMRSGASVLEADSYGDKVLLLADGTIV
FT                   KLFRRKRWLSSAAWYPYAKRFADNAASLRRLGIRVPEILDLFRIPSIERDAVRYQPLPG
FT                   RTLREIRREALDAGIEQELKEAFTRFVVSLHDSGVYFRSLHLGNVVYTPDHEFGLIDIS
FT                   DARIVDRPLRKYERARNLKRLQGIEGESEWVDLTSVVDAHRKRREARV"
FT                   /protein_id="YP_003165309.1"
FT   misc_feature    6686..7042
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:186871"
FT                   /locus_tag="CAP2UW1_0005"
FT   misc_feature    order(6686..6688,6773..6775,6827..6838,6959..6961,
FT                   6971..6976,6980..6982,7010..7015)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="CAP2UW1_0005"
FT   misc_feature    order(6686..6688,6773..6775,6827..6838,6959..6961,
FT                   6971..6976,6980..6982,7010..7015)
FT                   /note="active site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="CAP2UW1_0005"
FT   gene            complement(7183..7329)
FT                   /db_xref="GeneID:8402129"
FT                   /locus_tag="CAP2UW1_0006"
FT                   /pseudo
FT   gene            complement(7353..8054)
FT                   /db_xref="GeneID:8402130"
FT                   /locus_tag="CAP2UW1_0007"
FT   CDS_pept        complement(7353..8054)
FT                   /locus_tag="CAP2UW1_0007"
FT                   /gene_family="HOG000110564" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exsB protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: dar:Daro_4042 ExsB"
FT                   /db_xref="GI:257091669"
FT                   /db_xref="InterPro:IPR004479"
FT                   /db_xref="GeneID:8402130"
FT                   /translation="MDNKPTSSGGKPAVVLLSGGLDSATTLAIARADGFACHCLSIDYG
FT                   QRHRAELAAAALLAEALGAREHRQLRLTLEVFGGSALTDERIAVPVDGVHSGIPITYVP
FT                   ARNTVMLSLALAWAEVLGSRDIFVGVNAVDYSGYPDCRPEYIAAYEKMANLATRAAVQG
FT                   ASLTIHAPLMGLGKAEIIQRGITLGVDYGLTVSCYQADRDGRACGVCDSCRLRRAGFSA
FT                   AGMADPTRYAG"
FT                   /protein_id="YP_003165310.1"
FT   misc_feature    complement(7395..8018)
FT                   /note="ExsB is a transcription regulator related protein.
FT                   It is a subfamily of a Adenosine nucleotide binding
FT                   superfamily of proteins. This protein family is represented
FT                   by a single member in nearly every completed large (> 1000
FT                   genes) prokaryotic genome. In...; Region: ExsB; cd01995"
FT                   /db_xref="CDD:73293"
FT                   /locus_tag="CAP2UW1_0007"
FT   misc_feature    complement(order(7914..7916,7920..7922,7986..7997,
FT                   8001..8009))
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:73293"
FT                   /locus_tag="CAP2UW1_0007"
FT   gene            8309..9679
FT                   /db_xref="GeneID:8402131"
FT                   /locus_tag="CAP2UW1_0008"
FT   CDS_pept        8309..9679
FT                   /locus_tag="CAP2UW1_0008"
FT                   /gene_family="HOG000266020" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: nmu:Nmul_A0008
FT                   periplasmic sensor signal transduction histidine kinase"
FT                   /db_xref="GI:257091670"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:8402131"
FT                   /translation="MPPANHRQPPFFLTGTANPLVRLVMLRRIEVLMQAIVLVLAVTWL
FT                   GIPLEVVPMSALIALLAAVNLITQWRLDKGAPVSENEILLHLAFDAGILGLLLYFAGGS
FT                   ANPFVSLFLLPPTLAAAMLPARHAWAMAAITLAAYTSLIFWNLPLPSPRGDLAELDALL
FT                   ARATAGGEHAGHSNSFALHVLGMWLNFVISVGVVVFFLTRMAAALKDRERQLAAAREAT
FT                   LRNEQILALGTLAAGAAHQLGTPLGTMAIVIRELQLSHENDPEIREDLTLLREQVDRCK
FT                   QTISQILASTGQSRDESLRSMTLDAYLHRLLDEWQIIRPHALLSVALQGTQPAPLIAAD
FT                   RTLEQAILNLLDNAADANGASQEALRFAANWDGETCRIEILDCGPGLNVDAAERLGDMY
FT                   FSTKAITPERPGGIGIGLFLSNATVERFGGKVELFNRTDRRGGACTRVTLPMSRLKA"
FT                   /protein_id="YP_003165311.1"
FT   misc_feature    <8906..9658
FT                   /note="Osmosensitive K+ channel histidine kinase [Signal
FT                   transduction mechanisms]; Region: KdpD; COG2205"
FT                   /db_xref="CDD:32387"
FT                   /locus_tag="CAP2UW1_0008"
FT   misc_feature    9335..9655
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0008"
FT   misc_feature    order(9353..9355,9365..9367,9374..9376,9446..9448,
FT                   9452..9454,9458..9460,9464..9469,9548..9559,9605..9607,
FT                   9611..9613,9632..9637,9641..9643)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0008"
FT   misc_feature    9365..9367
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0008"
FT   misc_feature    order(9458..9460,9464..9466,9548..9550,9554..9556)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0008"
FT   gene            9685..10251
FT                   /db_xref="GeneID:8402132"
FT                   /locus_tag="CAP2UW1_0009"
FT   CDS_pept        9685..10251
FT                   /locus_tag="CAP2UW1_0009"
FT                   /gene_family="HOG000034817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix
FT                   Fis-type; KEGG: psa:PST_1004 probable two-component
FT                   response regulator"
FT                   /db_xref="GI:257091671"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:8402132"
FT                   /translation="MPERNLKQPDDERSTLLLVDDDDAFRRVLARALERRGYAVSVAAS
FT                   VEAALVKAQAQAPEYAVVDLKMPGESGLRLIDKLMELDPNTRIVMLTGYASIATAIEAI
FT                   KLGAVHYLAKPCDADEIVAALNKSSEGDAAMAVADSPLSIDRLEWEHIQRILGEHQGNV
FT                   SATARALKMHRRTLQRKLGKRPSRE"
FT                   /protein_id="YP_003165312.1"
FT   misc_feature    9727..10245
FT                   /note="Response regulator consisting of a CheY-like
FT                   receiver domain and a Fis-type HTH domain [Signal
FT                   transduction mechanisms / Transcription]; Region: COG4567"
FT                   /db_xref="CDD:34205"
FT                   /locus_tag="CAP2UW1_0009"
FT   misc_feature    9733..10065
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0009"
FT   misc_feature    order(9742..9747,9874..9876,9898..9900,9958..9960,
FT                   10015..10017,10024..10029)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0009"
FT   misc_feature    9874..9876
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0009"
FT   misc_feature    order(9883..9888,9892..9900)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0009"
FT   misc_feature    10024..10032
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0009"
FT   misc_feature    10111..10233
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:186327"
FT                   /locus_tag="CAP2UW1_0009"
FT   gene            10254..10658
FT                   /db_xref="GeneID:8402133"
FT                   /locus_tag="CAP2UW1_0010"
FT   CDS_pept        10254..10658
FT                   /locus_tag="CAP2UW1_0010"
FT                   /gene_family="HOG000216822" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding S4 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   tbd:Tbd_0509 RNA-binding S4 protein"
FT                   /db_xref="GI:257091672"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="GeneID:8402133"
FT                   /translation="MTTSGHPAIEYIRIDKWLWTARFYKTRSLAAQAIAAGHVRLAGHP
FT                   VKPARDLRCGDSLEIAIGDTIWSVVVRGLNEQRRPAVEAQQLYEETRASSERRATQRET
FT                   RLLAPVPGSDLRGRPTKKARRQIRGFNEGF"
FT                   /protein_id="YP_003165313.1"
FT   misc_feature    10287..>10433
FT                   /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
FT                   domain surface is populated by conserved, charged residues
FT                   that define a likely RNA-binding site;  Found in stress
FT                   proteins, ribosomal proteins and tRNA synthetases; This may
FT                   imply a hitherto unrecognized...; Region: S4; cd00165"
FT                   /db_xref="CDD:29105"
FT                   /locus_tag="CAP2UW1_0010"
FT   misc_feature    order(10290..10292,10326..10331,10335..10340,10344..10349,
FT                   10356..10361,10365..10367,10386..10391,10392..10406,
FT                   10410..10412)
FT                   /note="RNA binding surface; other site"
FT                   /db_xref="CDD:29105"
FT                   /locus_tag="CAP2UW1_0010"
FT   gene            10666..11022
FT                   /db_xref="GeneID:8402134"
FT                   /locus_tag="CAP2UW1_0011"
FT   CDS_pept        10666..11022
FT                   /locus_tag="CAP2UW1_0011"
FT                   /gene_family="HOG000076661" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reh:H16_A3595 hypothetical protein"
FT                   /db_xref="GI:257091673"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="GeneID:8402134"
FT                   /translation="MVNRLLADGIVVLHFLFIAFVVLGGVLARRWPRLAWVHLPAACWG
FT                   AAIELSGWICPLTPLENRFRQAAGEAGYAGSFIDHYLLPILYPVGLTREIQYGLAAVVI
FT                   VVNVAVYGCLLRRR"
FT                   /protein_id="YP_003165314.1"
FT   misc_feature    10672..11019
FT                   /note="Protein of Unknown function (DUF2784); Region:
FT                   DUF2784; pfam10861"
FT                   /db_xref="CDD:151310"
FT                   /locus_tag="CAP2UW1_0011"
FT   gene            complement(11079..12407)
FT                   /db_xref="GeneID:8402135"
FT                   /locus_tag="CAP2UW1_0012"
FT   CDS_pept        complement(11079..12407)
FT                   /locus_tag="CAP2UW1_0012"
FT                   /gene_family="HOG000062295" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF21"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: cvi:CV_0231 probable hemolysin"
FT                   /db_xref="GI:257091674"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="GeneID:8402135"
FT                   /translation="MDIVLLLFLILLNGVLAMSEIAVVSSRQSRLQKLADDGNRGARSA
FT                   LALSHEPSIFLSTVQVGITTVGILNGAIGETALAVPLAERLAAWPLLAPHAEGISLTVV
FT                   VAGLTYFSVVVGELVPKRLGLLSPERVASVIAPPMNLLARLARPLVWLLSSSSNLFLRL
FT                   LGARRTQESSVTDDEIKVLMGQGAQSGVFHASEQAIVANVLRLDEQRISAIMTHRKDIY
FT                   LLDLNESEEEIRERLAESPYKRVVVCRDGPDQIVGVLRTSDLLKGALAGEPLSIEPFVR
FT                   PALYVPAGVTTTQLLETFRRARQQCALMVDEYGELQGLVTLSDVLTAIVGDLPTSETPE
FT                   EQDIVIREDGSWLVDGSVPVERVKGFLTISGDWPGEDENAFNTLGGFIMYALGRIPSAS
FT                   DHFELADWRFEVVDMDGNRVDKVLIAKREHGSETAASAHVSAR"
FT                   /protein_id="YP_003165315.1"
FT   sig_peptide     complement(12348..12407)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.470 at
FT                   residue 20"
FT                   /locus_tag="CAP2UW1_0012"
FT   misc_feature    complement(11109..12359)
FT                   /note="Hemolysins and related proteins containing CBS
FT                   domains [General function prediction only]; Region: TlyC;
FT                   COG1253"
FT                   /db_xref="CDD:31445"
FT                   /locus_tag="CAP2UW1_0012"
FT   misc_feature    complement(11820..12359)
FT                   /note="Domain of unknown function DUF21; Region: DUF21;
FT                   pfam01595"
FT                   /db_xref="CDD:144983"
FT                   /locus_tag="CAP2UW1_0012"
FT   misc_feature    complement(11424..11753)
FT                   /note="This cd contains two tandem repeats of the
FT                   cystathionine beta-synthase (CBS pair) domains associated
FT                   with the CorC_HlyC domain. CorC_HlyC is a transporter
FT                   associated domain. This small domain is found in Na+/H+
FT                   antiporters, in proteins involved in...; Region:
FT                   CBS_pair_CorC_HlyC_assoc; cd04590"
FT                   /db_xref="CDD:73090"
FT                   /locus_tag="CAP2UW1_0012"
FT   misc_feature    complement(11127..11369)
FT                   /note="Transporter associated domain; Region: CorC_HlyC;
FT                   pfam03471"
FT                   /db_xref="CDD:146225"
FT                   /locus_tag="CAP2UW1_0012"
FT   gene            complement(12457..13248)
FT                   /db_xref="GeneID:8402136"
FT                   /locus_tag="CAP2UW1_0013"
FT   CDS_pept        complement(12457..13248)
FT                   /locus_tag="CAP2UW1_0013"
FT                   /gene_family="HOG000105514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: eba:ebA234 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type I; PFAM:
FT                   dehydroquinase class I"
FT                   /db_xref="GI:257091675"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="GeneID:8402136"
FT                   /translation="MGDLGMSKGIDVRGQPLAGGKEPLICTPLVARDEPSILREVAVVC
FT                   AKCPDLIEWRVDFFAGIADSARVVALAREIRKQAGSVPIIFTRRSTREGGEPIGIEEEQ
FT                   VLSLYRAVCETGCVDFVDYEINNEPQHFQAARQAAHHSGAQLIASFHDFQQTPPAAEIV
FT                   AKLVTMEEAGADIAKVAVTPRAIDDVLTLLGATLAGSRQLRLPIISVSMGPYGSLSRLF
FT                   GWTFGSSVTFAVGDKASAPGQVAIEDLRIVLDILRRSLAGK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165316.1"
FT   misc_feature    complement(12484..13179)
FT                   /note="Type I 3-dehydroquinase, (3-dehydroquinate
FT                   dehydratase or DHQase.) Catalyzes the cis-dehydration of
FT                   3-dehydroquinate via a covalent imine intermediate to
FT                   produce dehydroshikimate. Dehydroquinase is the third
FT                   enzyme in the shikimate pathway, which is...; Region:
FT                   DHQase_I; cd00502"
FT                   /db_xref="CDD:29939"
FT                   /locus_tag="CAP2UW1_0013"
FT   misc_feature    complement(12490..13179)
FT                   /note="3-dehydroquinate dehydratase, type I; Region: aroD;
FT                   TIGR01093"
FT                   /db_xref="CDD:162199"
FT                   /locus_tag="CAP2UW1_0013"
FT   misc_feature    complement(order(12520..12522,12529..12534,12589..12591,
FT                   12715..12717,12796..12798,12982..12984,13084..13086,
FT                   13090..13092,13165..13167))
FT                   /note="active site"
FT                   /db_xref="CDD:29939"
FT                   /locus_tag="CAP2UW1_0013"
FT   misc_feature    complement(12715..12717)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29939"
FT                   /locus_tag="CAP2UW1_0013"
FT   misc_feature    complement(order(12484..12486,12493..12495,12505..12507,
FT                   12571..12573,12583..12588,12658..12660,12667..12669,
FT                   12679..12681))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29939"
FT                   /locus_tag="CAP2UW1_0013"
FT   gene            complement(13249..14010)
FT                   /db_xref="GeneID:8402137"
FT                   /locus_tag="CAP2UW1_0014"
FT   CDS_pept        complement(13249..14010)
FT                   /locus_tag="CAP2UW1_0014"
FT                   /gene_family="HOG000258483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Integral membrane protein TerC"
FT                   /transl_table="11"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   pol:Bpro_3668 integral membrane protein TerC"
FT                   /db_xref="GI:257091676"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="GeneID:8402137"
FT                   /translation="MDVMSLLASPQAWLAFATLTALELVLGIDNIIFISILVDRLPPAT
FT                   REKARKLGLFLAMFLRIALLLLLSVIVGATAPLFSAFGQAISPRDLILIGGGVFLIWKS
FT                   TQEIHQLLEGQEGHASTAVRATFSAIILQIIVIDIVFSLDSIITAVGMVDEVAVMIAAV
FT                   VASVGLMMLFAAAIGRFVSGHPTIKMLALSFLMVVGVALVAEGFGHKVPKGYIYFAMAF
FT                   SVTVEMLNIRLRRKSVPPVHLHQPYTRRESD"
FT                   /protein_id="YP_003165317.1"
FT   misc_feature    complement(13303..14001)
FT                   /note="Integral membrane protein TerC family; Region: TerC;
FT                   cl10468"
FT                   /db_xref="CDD:187000"
FT                   /locus_tag="CAP2UW1_0014"
FT   gene            14455..15138
FT                   /db_xref="GeneID:8402138"
FT                   /locus_tag="CAP2UW1_0015"
FT   CDS_pept        14455..15138
FT                   /locus_tag="CAP2UW1_0015"
FT                   /gene_family="HOG000257417" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   dar:Daro_3533 lytic transglycosylase, catalytic"
FT                   /db_xref="GI:257091677"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:8402138"
FT                   /translation="MSATISLKSITGRRTDATLSFIQHSMMIVGLMLLLGAVKPLFGGR
FT                   SDTDAQQAAEVATVSEAAEAEPVKAAPEALPPHLQRVLDFVSRRYRVAPEALVPVFEAA
FT                   QTVGRERRVDPLLIIAIIGIESRFNPFAESAFGAKGLMQVIPGYHMDKVPQGAGEQPFL
FT                   DPVTNIQVGVHVLEEAIRWRGGLTAGLQHYGGAPDDPETGYANKVLAEKQRLEQAARRG
FT                   PGARV"
FT                   /protein_id="YP_003165318.1"
FT   misc_feature    14797..15084
FT                   /note="Lytic Transglycosylase (LT)  and Goose Egg White
FT                   Lysozyme (GEWL) domain. Members include the soluble and
FT                   insoluble membrane-bound LTs in bacteria, the LTs in
FT                   bacteriophage lambda, as well as, the eukaryotic
FT                   'goose-type' lysozymes (GEWL).  LTs catalyze...; Region:
FT                   LT_GEWL; cd00254"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="CAP2UW1_0015"
FT   misc_feature    order(14827..14829,14887..14889,14977..14979)
FT                   /note="N-acetyl-D-glucosamine binding site; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="CAP2UW1_0015"
FT   misc_feature    14827..14829
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="CAP2UW1_0015"
FT   gene            complement(15192..17663)
FT                   /db_xref="GeneID:8402139"
FT                   /locus_tag="CAP2UW1_0016"
FT   CDS_pept        complement(15192..17663)
FT                   /locus_tag="CAP2UW1_0016"
FT                   /gene_family="HOG000218231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   hch:HCH_05086 glycerol-3-phosphate acyltransferase"
FT                   /db_xref="GI:257091678"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR006025"
FT                   /db_xref="GeneID:8402139"
FT                   /translation="MAEFFKVSDWFIPLARRLLYLWVRTTVFPASVQELGLDPGKPVCY
FT                   VLQDRHLSNLLVLFEESRQAGLPRAEAPMAIGGQRLPRSFFFLNRDRRLAGRARDGGAH
FT                   SPLLASLLGQAVADPQVDVQLVPVLILWGRSPDQQDSILKALFSETWRPPGAWRQLLAI
FT                   LLHGRHVLVRYNAPISLRELLQGGLAEEPALRKLSRVLRVHFRRQRQMAIGPDLSHRNT
FT                   QVNAVLAGEQVRLAIASEAATQGISPAEARARAARFALEISSDYSYGVVRALELFLNWL
FT                   WTRLYDGIELHNFDVVSRIAAGHEIVYVPCHRSHIDYLLLSYIIHRQGLTPPHIAAGAN
FT                   LNLPLVGSLLRRGGAFFLRRSFKGEPLYAAVFHEYLHLMLARGFPIEYFIEGGRSRSGR
FT                   MLAPKAGILGMTVQSFIREHVRPLVFLPVYIGYEKVMEGRTYLDELAGQPKQRESLWGL
FT                   FMSVRSIKRVFGKVHVNFGAPLALAGFLDVQQPGWRDEPAETLSHWSRRATRHAAAELA
FT                   KRINEAAVLNPVNLVALSLLATPKHTADEHALQRMIEHYQALSSLAPYAPTTIGCALDP
FT                   QQVVGYAERLTLVERFRDPLGDLIRAPREQAPLLAYFRNNVLHLFALPAVIACLVSHNR
FT                   DLDAARVAQAVAGICSLMRAELFLRWSGDELAAASEAIIRVLLARALLRHPEAEGRLAA
FT                   PEPISQEFVELRLLGETIRPLLERHFLTLALLERHGSGHLTRPALEDNCHRLAQRLSLL
FT                   YEFNTPEFPEKVTFAAFIGNLIEGEFLHETEDGLLHFDERLLTPLAHSELVLSVEARQA
FT                   IRRMARAGVAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165319.1"
FT   misc_feature    complement(15282..17624)
FT                   /note="Glycerol-3-phosphate O-acyltransferase [Lipid
FT                   metabolism]; Region: PlsB; COG2937"
FT                   /db_xref="CDD:32760"
FT                   /locus_tag="CAP2UW1_0016"
FT   misc_feature    complement(16203..16808)
FT                   /note="Lysophospholipid Acyltransferases (LPLATs) of
FT                   Glycerophospholipid Biosynthesis: GPAT-like; Region:
FT                   LPLAT_DHAPAT-like; cd07993"
FT                   /db_xref="CDD:153255"
FT                   /locus_tag="CAP2UW1_0016"
FT   misc_feature    complement(order(16482..16490,16641..16652,16713..16715,
FT                   16719..16721,16728..16730))
FT                   /note="putative acyl-acceptor binding pocket; other site"
FT                   /db_xref="CDD:153255"
FT                   /locus_tag="CAP2UW1_0016"
FT   gene            complement(17696..19744)
FT                   /db_xref="GeneID:8402140"
FT                   /locus_tag="CAP2UW1_0017"
FT   CDS_pept        complement(17696..19744)
FT                   /locus_tag="CAP2UW1_0017"
FT                   /gene_family="HOG000231587" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small GTP-binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: elongation
FT                   factor G domain protein; protein synthesis factor
FT                   GTP-binding; elongation factor G domain IV; KEGG:
FT                   rfr:Rfer_1382 elongation factor G"
FT                   /db_xref="GI:257091679"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002362"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="GeneID:8402140"
FT                   /translation="MGQTATSNLRTVALVGHGASGKTTLAESLLAAAGAIASRGAVEKG
FT                   NTVCDFDPQEKEFGHSLSSALASFSWQGVLVHLIDTPGFPDFAGQAIGALAAADTALVV
FT                   INAQNGIELSSERMMKLAEARGVCRMIVINKIDADNVNLPALVGEIRERFGRECMLLDL
FT                   PAKHGSEVVELLGHDAGESDFESVAAAHRALIDQIVEEDEDLLARYLEEGVDPSPDELH
FT                   VPFEKALRAGHLIPILFVSAKTGAGIPQLLDVLARLAPNPHEGNPPPFYRGEPGGPAEA
FT                   FAAVPDPHKHVLAHVFKVVSDPFIGKVGVFRVHQGTIRKDSQLFVGDGKRPFKVGHIYR
FT                   LQGKEYVEVESLAPGDLGAIAKVDEIEFDCVLHDSHDEDQIHLKPLEFPQPMQGLAVQA
FT                   RRKADEQRLFEILRKLEVEDPCFRLERHPTTNETVIRGLGEMHLRAKLNRLSQQYKLEL
FT                   DTKPPQIAYREAITGSAEGHCRHKKQSGGAGQFGEVALRVEPLERGAGFEFVDIVKGGV
FT                   IPGVFMAAVEKGVRQALADGVVAGFPVEDLRVTVHDGKSHPVDGKDIAFFTAARKATVE
FT                   AIRGAKPIILEPVVDIEILAPEAMTGDLTGDLSSKRGHLTGTQPRGPGVMAITGEVPLA
FT                   ELDGYQSRLKSLTGGQGSYSIAFSHYAQVPPATQQHLASQHKVVEEE"
FT                   /protein_id="YP_003165320.1"
FT   misc_feature    complement(18959..19714)
FT                   /note="Elongation factor G (EF-G) subfamily. Translocation
FT                   is mediated by EF-G (also called translocase).  The
FT                   structure of EF-G closely resembles that of the complex
FT                   between EF-Tu and tRNA.  This is an example of molecular
FT                   mimicry; a protein domain evolved...; Region: EF-G_bact;
FT                   cd04170"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(17726..19702)
FT                   /note="elongation factor G; Reviewed; Region: PRK12740"
FT                   /db_xref="CDD:183713"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(19676..19699)
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(order(19298..19300,19310..19312,19418..19423,
FT                   19490..19495,19547..19552,19652..19657,19664..19666,
FT                   19673..19678,19688..19690,19694..19696))
FT                   /note="putative GEF interaction site; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(order(19016..19018,19022..19024,19331..19336,
FT                   19340..19342,19496..19498,19562..19567,19673..19693))
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(order(19550..19552,19556..19570))
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(19565..19567)
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(19496..19507)
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(19445..19501)
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(19334..19345)
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(19016..19024)
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133370"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(18644..18871)
FT                   /note="EFG_mtEFG_II: this subfamily represents the domain
FT                   II of elongation factor G (EF-G) in bacteria and, the
FT                   C-terminus of mitochondrial Elongation factor G1 (mtEFG1)
FT                   and G2 (mtEFG2)_like proteins found in eukaryotes. During
FT                   the process of peptide...; Region: EFG_mtEFG_II; cd04088"
FT                   /db_xref="CDD:58095"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(17999..18346)
FT                   /note="EFG_mtEFG1_IV: domains similar to domain IV of the
FT                   bacterial translational elongation factor (EF) EF-G.
FT                   Included in this group is a domain of mitochondrial
FT                   Elongation factor G1 (mtEFG1) proteins homologous to domain
FT                   IV of EF-G. Eukaryotic cells harbor...; Region:
FT                   EFG_mtEFG1_IV; cd01434"
FT                   /db_xref="CDD:58274"
FT                   /locus_tag="CAP2UW1_0017"
FT   misc_feature    complement(17750..17986)
FT                   /note="EFG_mtEFG_C: domains similar to the C-terminal
FT                   domain of the bacterial translational elongation factor
FT                   (EF) EF-G.  Included in this group is the C-terminus of
FT                   mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)
FT                   proteins. Eukaryotic cells harbor...; Region: EFG_mtEFG_C;
FT                   cd03713"
FT                   /db_xref="CDD:58065"
FT                   /locus_tag="CAP2UW1_0017"
FT   gene            19993..22290
FT                   /db_xref="GeneID:8402141"
FT                   /locus_tag="CAP2UW1_0018"
FT   CDS_pept        19993..22290
FT                   /locus_tag="CAP2UW1_0018"
FT                   /gene_family="HOG000132448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+)), Phosphate
FT                   acetyltransferase"
FT                   /EC_number="1.1.1.40"
FT                   /EC_number="2.3.1.8"
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; malic
FT                   protein domain protein; malic protein NAD-binding; KEGG:
FT                   dar:Daro_3943 malic enzyme"
FT                   /db_xref="GI:257091680"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="GeneID:8402141"
FT                   /translation="MENDQPDQRQADLREAALEYHRYPTAGKISVQPTKALSNQLDLAL
FT                   AYSPGVAYACHAIVDDPGSVSLYSSRANLVGVITNGTAVLGLGNIGPLAAKPVMEGKGC
FT                   LFKKFAGIDVFDIELAESDPDRLIDMIAAMEPTLGGINLEDIKAPECFYIEAKLKERMS
FT                   IPVFHDDQHGTAIISAAAILNALKVTGKPIGDVTVVCSGAGAAAISCLNLWCDLGFRRE
FT                   NIVVCDSKGVIYVGRDADMEPTKARYARETGVRTLAEALVGADVFLGLSAAGILQPEML
FT                   ATMAEQPIVFALANPTPEIMPELAREVRPDVIMATGRSDYPNQVNNVLCFPFIFRGALD
FT                   VGATGINEQMKMACVKALAAMAHQEVSDEVAMAYPGQELSFGPEYLIPKPFDPRLITTI
FT                   APAVAEAAMLSGIATRPLGDLTAYREKLREFVYRTGVGMRAVFSAAKRGRKTRIVYPDG
FT                   EEERMLRAAQTILDEGLTRPILIGRPDVIASRLERIGSKLRVGKDFELVDPNSDGRYKE
FT                   CWTAYHQLRKRQGVTIDIAKTRLRNNNTIIAAMLLRLGYADGMICGLSGRFGHHLRQVD
FT                   EIIGKAPGCNTMAAMTHLLLPGRALFLCDTHVNADPDTNQLVEIALMAADAVRRFKIKP
FT                   KVALLSHSNFGSSQTPSARKMAEAVAIIRARAPELAIDGEMHGDSALSQAIRRQADPES
FT                   PLVGEANVLVMPNLDAANISHHLLKMTGGDGMAVGPILLGAARPVHVLSPTSTVRRVVD
FT                   MTALVVVDAATK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165321.1"
FT   misc_feature    20026..22284
FT                   /note="bifunctional malic enzyme
FT                   oxidoreductase/phosphotransacetylase; Reviewed; Region:
FT                   PRK07232"
FT                   /db_xref="CDD:180898"
FT                   /locus_tag="CAP2UW1_0018"
FT   misc_feature    20071..20469
FT                   /note="Malic enzyme, N-terminal domain; Region: malic;
FT                   pfam00390"
FT                   /db_xref="CDD:144108"
FT                   /locus_tag="CAP2UW1_0018"
FT   misc_feature    20503..21213
FT                   /note="NAD(P) binding domain of malic enzyme (ME), subgroup
FT                   2; Region: NAD_bind_2_malic_enz; cd05311"
FT                   /db_xref="CDD:133453"
FT                   /locus_tag="CAP2UW1_0018"
FT   misc_feature    order(20599..20610,20674..20679,20800..20805,20815..20817,
FT                   20869..20877,20941..20943,20965..20967,20971..20973)
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:133453"
FT                   /locus_tag="CAP2UW1_0018"
FT   misc_feature    21304..22287
FT                   /note="Phosphate acetyl/butaryl transferase; Region:
FT                   PTA_PTB; cl00390"
FT                   /db_xref="CDD:185961"
FT                   /locus_tag="CAP2UW1_0018"
FT   gene            22372..22447
FT                   /note="tRNA-Ala1"
FT                   /db_xref="GeneID:8402142"
FT                   /locus_tag="CAP2UW1_R0001"
FT   tRNA            22372..22447
FT                   /db_xref="GeneID:8402142"
FT                   /locus_tag="CAP2UW1_R0001"
FT                   /product="tRNA-Ala"
FT   gene            22473..22548
FT                   /note="tRNA-Glu1"
FT                   /db_xref="GeneID:8402143"
FT                   /locus_tag="CAP2UW1_R0002"
FT   tRNA            22473..22548
FT                   /db_xref="GeneID:8402143"
FT                   /locus_tag="CAP2UW1_R0002"
FT                   /product="tRNA-Glu"
FT   gene            23173..24732
FT                   /db_xref="GeneID:8402144"
FT                   /locus_tag="CAP2UW1_0019"
FT   CDS_pept        23173..24732
FT                   /locus_tag="CAP2UW1_0019"
FT                   /gene_family="HOG000128894" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   rru:Rru_A0873 hypothetical protein"
FT                   /db_xref="GI:257091681"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="GeneID:8402144"
FT                   /translation="MKKFGLSLIALSLLPIPGWGNDIGAEVQSAAAPKTPAIKTITNFT
FT                   QSLRCMDELLYAYGKQGIAITSTGIPDETGKVKTGTKEMLITAVSKMTVKSNAFDFIDF
FT                   HSGADDLGALFAARGDQNRLMPDYYIRGSITQMDDNSVRKNKGVGFSLPFLDLGVSKDD
FT                   AYDLISMDLSIGDAATRKIIPITSTSNTLVLMKGGISGEGGGKIGKVGLSFNIDVSRSE
FT                   GVGAATRTLVELGLIETLGKFTQVPYWKCLDTDLTNPLIREQAREWFDNAKENDRILFV
FT                   QRKLAGMGRYDGPLNGAMNATLKTSISEYQAASGLIADGTINFDLYASLLDNLQNQIAA
FT                   LPAAGGPKSNYVPGVSPASRPPAVTQVVATPAAGPMNAPNPIFKMKLDTDRGSKPAYRV
FT                   GDFLNLTLSMNTQGTAYCYYQDVSATTARIFPNQFRSDSSVPAGAGVRIPSGGFKIRFD
FT                   RPGPERVACIGSDRELVIPGSLRGARDLSPLPVKSVDEVIGQYKQNNPSAVVSMVDITV
FT                   SQ"
FT                   /protein_id="YP_003165322.1"
FT   sig_peptide     23173..23235
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.973 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_0019"
FT   misc_feature    <23386..>23739
FT                   /note="Curli production assembly/transport component CsgG;
FT                   Region: CsgG; cl00639"
FT                   /db_xref="CDD:186119"
FT                   /locus_tag="CAP2UW1_0019"
FT   gene            24971..25246
FT                   /db_xref="GeneID:8402145"
FT                   /locus_tag="CAP2UW1_0020"
FT   CDS_pept        24971..25246
FT                   /locus_tag="CAP2UW1_0020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091682"
FT                   /db_xref="GeneID:8402145"
FT                   /translation="MNSPNVVIINGVNNGVGGNDWSATGSPAANSAAHNKRRATENRVF
FT                   LGDDAPTPAVVVVPSGQNAAPYYGSPAEESASRNAARANAYRQRND"
FT                   /protein_id="YP_003165323.1"
FT   gene            25285..25611
FT                   /db_xref="GeneID:8402146"
FT                   /locus_tag="CAP2UW1_0021"
FT   CDS_pept        25285..25611
FT                   /locus_tag="CAP2UW1_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091683"
FT                   /db_xref="GeneID:8402146"
FT                   /translation="MRFPAAVFLFGFSQLTAAQVSIDLPGVSVKTGAGSSVSKSGNTVA
FT                   NEKGVISPDADVEGVVIINDALSIDGVPIARGVTEYVSKKTRKVYSIRWGKKGEGVTVT
FT                   EKTR"
FT                   /protein_id="YP_003165324.1"
FT   sig_peptide     25285..25341
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.602 at
FT                   residue 19"
FT                   /locus_tag="CAP2UW1_0021"
FT   gene            25654..26559
FT                   /db_xref="GeneID:8402147"
FT                   /locus_tag="CAP2UW1_0022"
FT   CDS_pept        25654..26559
FT                   /locus_tag="CAP2UW1_0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: acr:Acry_2861 hypothetical protein"
FT                   /db_xref="GI:257091684"
FT                   /db_xref="GeneID:8402147"
FT                   /translation="MRLPQFVNRVVLVLGLAAGLLGSAFVGAFEVKEGDLKTIFYAKTD
FT                   VPVVWRYTPNSEVMILDMPGLELLGRTFNRVTQLTEQQYTEAYPRVLTSQELSRYIGNA
FT                   HRTFANFAAGHDLRISDLVQFFNLADRDKVELFPEEYALRDFLLQQGLIKEWRGFYQAQ
FT                   KPHSIILSIPQVQDRRGNEPALTSQARYAILLHELSHAEFHTNAAYNKYCRGFWASGLT
FT                   ESQREAFRKFLAGMRYSVENEELVINEMQAYLVFTPDAGAFSAARLGVSESSLAGMREA
FT                   FVRGRPPVQLPLRVKAGELP"
FT                   /protein_id="YP_003165325.1"
FT   sig_peptide     25654..25740
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.975 at
FT                   residue 29"
FT                   /locus_tag="CAP2UW1_0022"
FT   gene            26556..26867
FT                   /db_xref="GeneID:8402148"
FT                   /locus_tag="CAP2UW1_0023"
FT   CDS_pept        26556..26867
FT                   /locus_tag="CAP2UW1_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091685"
FT                   /db_xref="GeneID:8402148"
FT                   /translation="MSKRFSMGWCAVFLVGAGIPLSCLAQKTTRIQGNTEINASSNNTT
FT                   AVAVGSNVVAKNRVGVVQGDKKGNTRINVSTSNVTTVVSGRNKKACTNIGAIVSDECK"
FT                   /protein_id="YP_003165326.1"
FT   sig_peptide     26556..26633
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_0023"
FT   gene            26854..27159
FT                   /db_xref="GeneID:8402149"
FT                   /locus_tag="CAP2UW1_0024"
FT   CDS_pept        26854..27159
FT                   /locus_tag="CAP2UW1_0024"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091686"
FT                   /db_xref="GeneID:8402149"
FT                   /translation="MNASKPILAQYLVAAIFCATTGVASAVQNLNASSQTKVNNAMAKA
FT                   WQKGGNPNDPALQKRVVNIGSKKAGTCDVNVGTVQPGQRAPKDIVVTTKEVINVCK"
FT                   /protein_id="YP_003165327.1"
FT   sig_peptide     26854..26934
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.885 at
FT                   residue 27"
FT                   /locus_tag="CAP2UW1_0024"
FT   gene            27168..27776
FT                   /db_xref="GeneID:8402150"
FT                   /locus_tag="CAP2UW1_0025"
FT   CDS_pept        27168..27776
FT                   /locus_tag="CAP2UW1_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="OmpA/MotB domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rru:Rru_A0870
FT                   OmpA/MotB"
FT                   /db_xref="GI:257091687"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="GeneID:8402150"
FT                   /translation="MKTNLYRVALVAAFVTLTGGATVLPAAAADDETSSLDELRRAMTE
FT                   PSEAPKKKRTRAIVFDGDSAQAPASAAPAAAGGALDCAALPPDVRATAVQFPIQFRPGS
FT                   ANITPASGNTLIEIAKILSLTPDRCIIVEGHTDAEGNADRNMALSRDRANSVVKFISDK
FT                   GAVERRRLVPVGKGSTDPLKDLDPRDSRNRRVVFKVVAG"
FT                   /protein_id="YP_003165328.1"
FT   sig_peptide     27168..27254
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.885 at
FT                   residue 29"
FT                   /locus_tag="CAP2UW1_0025"
FT   misc_feature    27450..27764
FT                   /note="Peptidoglycan binding domains similar to the
FT                   C-terminal domain of outer-membrane protein OmpA; Region:
FT                   OmpA_C-like; cd07185"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="CAP2UW1_0025"
FT   misc_feature    order(27471..27476,27573..27578,27585..27587,27597..27602,
FT                   27609..27611,27732..27734,27744..27746)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="CAP2UW1_0025"
FT   gene            27825..28115
FT                   /db_xref="GeneID:8402151"
FT                   /locus_tag="CAP2UW1_0026"
FT   CDS_pept        27825..28115
FT                   /locus_tag="CAP2UW1_0026"
FT                   /gene_family="HOG000158243" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rru:Rru_A0876 hypothetical protein"
FT                   /db_xref="GI:257091688"
FT                   /db_xref="GeneID:8402151"
FT                   /translation="MRTISTLIIAAAFAASPAFAQKTEVKGKTEIDAKQENVAAVAIGK
FT                   DNTAKNTAGAIKGDTKVQGNTKIKAEQKNAAAVAIGKGNTAANEAGVIGGK"
FT                   /protein_id="YP_003165329.1"
FT   sig_peptide     27825..27887
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_0026"
FT   gene            28440..28934
FT                   /db_xref="GeneID:8402152"
FT                   /locus_tag="CAP2UW1_0027"
FT   CDS_pept        28440..28934
FT                   /locus_tag="CAP2UW1_0027"
FT                   /gene_family="HOG000133736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_3598 hypothetical protein"
FT                   /db_xref="GI:257091689"
FT                   /db_xref="GeneID:8402152"
FT                   /translation="MFRTGMHNTIPVTVAKGVFCLFLLHTGTARAAEPGAPGAPIWGAQ
FT                   VKVSRGVVSIERDGQRYPGIVGARLKEKDVIQTGGNGSVGIMFNDNSTLSLGPDAEVLL
FT                   QRYAYDSTTYMGAFDAYIKRGTVSVQAGNIAKQAPEAMRMVTPKAEVTGTAKNYVVSVG
FT                   E"
FT                   /protein_id="YP_003165330.1"
FT   sig_peptide     28440..28535
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.982 at
FT                   residue 32"
FT                   /locus_tag="CAP2UW1_0027"
FT   misc_feature    28593..>28838
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG4254"
FT                   /db_xref="CDD:33977"
FT                   /locus_tag="CAP2UW1_0027"
FT   gene            28938..29534
FT                   /db_xref="GeneID:8402153"
FT                   /locus_tag="CAP2UW1_0028"
FT   CDS_pept        28938..29534
FT                   /locus_tag="CAP2UW1_0028"
FT                   /gene_family="HOG000219736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="OmpA/MotB domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: dar:Daro_3597
FT                   OmpA/MotB"
FT                   /db_xref="GI:257091690"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="GeneID:8402153"
FT                   /translation="MKRLAITLALSLMTTACAHRDTYVLLPDGSGQAPGALTIKPAEGG
FT                   NALKLDQPYQTARSTMGGGLEAGRTDEQEVRKRYGAAIDASPPPLVRFTLYFLEGSDEL
FT                   TAASKTELVAILAEIKARPVPDIVIVGHTDRVGMVADNDRLALRRADSFRKKLLQQGIA
FT                   DEAIQTAGRGEREPLVNTPDETPEPRNRRVEILVR"
FT                   /protein_id="YP_003165331.1"
FT   sig_peptide     28938..28994
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT                   /locus_tag="CAP2UW1_0028"
FT   misc_feature    29004..29531
FT                   /note="Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins [Cell envelope
FT                   biogenesis, outer membrane]; Region: OmpA; COG2885"
FT                   /db_xref="CDD:32711"
FT                   /locus_tag="CAP2UW1_0028"
FT   misc_feature    29211..29528
FT                   /note="Peptidoglycan binding domains similar to the
FT                   C-terminal domain of outer-membrane protein OmpA; Region:
FT                   OmpA_C-like; cd07185"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="CAP2UW1_0028"
FT   misc_feature    order(29232..29237,29334..29339,29346..29348,29358..29363,
FT                   29370..29372,29496..29498,29508..29510)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="CAP2UW1_0028"
FT   gene            29557..32550
FT                   /db_xref="GeneID:8402154"
FT                   /locus_tag="CAP2UW1_0029"
FT   CDS_pept        29557..32550
FT                   /locus_tag="CAP2UW1_0029"
FT                   /gene_family="HOG000157012" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /transl_table="11"
FT                   /note="PFAM: WD-40 repeat protein; peptidase C14 caspase
FT                   catalytic subunit p20; KEGG: glo:Glov_1608 peptidase C14
FT                   caspase catalytic subunit P20"
FT                   /db_xref="GI:257091691"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="GeneID:8402154"
FT                   /translation="MITRVLHALVLFGLVVGQLVGGEAQGQVSVEPILRIETGGHQSLV
FT                   TRVSTDAQGRWVLTASEDKTARLWDAATGKLLSVLRPPIGPEGVGAIYAAALSPDGKQI
FT                   ALGGNAAFDGKTHSLYLFDRASGRLPAKSTLSGLEAPLTQLAWSKDSQLVAVGLRQSGL
FT                   RVFQRNLGFVGSDPEYNEAIYGADFSTDGRLVTCSLDGSVRLYRVDKKGLVRTARKQLA
FT                   SGRPYSVAFSPDGSLIAVGYQDAGHIDVLDAASLTPVYATPSSKEGNLGRVAWTGDGRV
FT                   LIGAGTARANERFAVFAFGDAGRGPARELAGFTNIVTALAPLRDGVIVATAEPSWASFD
FT                   AAGNRRLLARPQTGDFRDAGDRFKVSVDAQLVSFPTIPGGESLVFDLVKGDLRRPGSEA
FT                   KVEPPRQPGWGGGPSNWKNSTTPKLGSRQLQLRPGEVSRSVALSPDKQRFVLGTEWYLR
FT                   AFDSEGSQVWEQRTPAAVWATNISGDGRWVLAALGDGTVRWYRMQDGREQLSLFVHVDG
FT                   KRWIIWSPAGFYDTSLDGEDLVGWHLNRAMNQASDFFSVGRFRDRFYRPEIIQSIIQTG
FT                   DEGEAIRQAQAAAAALAATEPPALPATAGASKGAGSLPPRPAVAVEKTAVATVLPPVID
FT                   LQTESQIESSASTVPVRFVLRSPSDAPVSEVKVRVNDKLVRSLDNRALRSARGEAQEVQ
FT                   VAVPPVDSQIRLFAANKYGKSEPVVINIRRSAAPSGKVAETRFETLYLLIIGVSKYPEE
FT                   WKLDLAEKDARDFNHHMVRQAGQLYGTAQPRLLINEQASREKILEGLRWLRESVGEKDA
FT                   GVVFMAGHGDRVGSAYYFIPGDPDVLPSRSEFKSTQEFDAWKQKNAPKRWVPGEEISRT
FT                   LLGLKGRAAFFIDTCHSGINARPGQSTNPDLTKALNEINEERGVIVFASSTGKELSQED
FT                   PAWGNGAFTKAIIEGIRGGADFRKDGLIRPSTLQSYVTDRVMELTKKEQRPVIFTVGID
FT                   EPIAVRGQ"
FT                   /protein_id="YP_003165332.1"
FT   sig_peptide     29557..29622
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.333 at
FT                   residue 22"
FT                   /locus_tag="CAP2UW1_0029"
FT   misc_feature    29674..30555
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cl02567"
FT                   /db_xref="CDD:154987"
FT                   /locus_tag="CAP2UW1_0029"
FT   misc_feature    order(29677..29679,29731..29733,29743..29745,29761..29766,
FT                   29800..29805,29872..29874,29884..29886,29920..29925,
FT                   29965..29970,30019..30021,30034..30036,30052..30057,
FT                   30091..30093,30142..30144,30154..30156,30172..30177,
FT                   30211..30216,30274..30276,30286..30288,30307..30312,
FT                   30349..30354,30403..30405,30418..30420,30451..30456,
FT                   30490..30495,30547..30549)
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="CAP2UW1_0029"
FT   misc_feature    <30868..31161
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cl02567"
FT                   /db_xref="CDD:154987"
FT                   /locus_tag="CAP2UW1_0029"
FT   misc_feature    31783..32505
FT                   /note="Caspase, interleukin-1 beta converting enzyme (ICE)
FT                   homologues; Cysteine-dependent aspartate-directed proteases
FT                   that mediate programmed cell death (apoptosis). Caspases
FT                   are synthesized as inactive zymogens and activated by
FT                   proteolysis of the peptide...; Region: CASc; cl00042"
FT                   /db_xref="CDD:185785"
FT                   /locus_tag="CAP2UW1_0029"
FT   gene            32575..33258
FT                   /db_xref="GeneID:8402155"
FT                   /locus_tag="CAP2UW1_0030"
FT   CDS_pept        32575..33258
FT                   /locus_tag="CAP2UW1_0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="17 kDa surface antigen"
FT                   /transl_table="11"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG:
FT                   bur:Bcep18194_C6770 hypothetical protein"
FT                   /db_xref="GI:257091692"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="GeneID:8402155"
FT                   /translation="MTNSRFTLRRSAAALASVILVTACATNPDGSTRMDDRATGALIGA
FT                   AAGCAVGAAVNGGKGCLVGAAAGAAVGFLIGWYFESKKIASANDVNAEYKKKKGQVVPK
FT                   DDVKPAKFDTVVKPGVPEKDGQREVQVTSNTDLIGYGDKAPEVTQKYAIYDENNKLVEE
FT                   KSERVAAVDGAGRYQTDSKFKLPASAKGKKYTVKTSLVANNQTYKENSYKVSVLDDGFM
FT                   IAMAN"
FT                   /protein_id="YP_003165333.1"
FT   sig_peptide     32575..32652
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.875 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_0030"
FT   misc_binding    33502..33601
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 45.16"
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT   gene            33698..35614
FT                   /db_xref="GeneID:8402156"
FT                   /locus_tag="CAP2UW1_0031"
FT   CDS_pept        33698..35614
FT                   /locus_tag="CAP2UW1_0031"
FT                   /gene_family="HOG000224484" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   dar:Daro_3921 thiamine biosynthesis protein ThiC"
FT                   /db_xref="GI:257091693"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="GeneID:8402156"
FT                   /translation="MNANDKFIATDAHVDQAAIKPLPNSRKVYVTGSRPDIRVPMREIS
FT                   QSDTDTAFGGEKNPPIYVYDCSGPYSDPLAKIDIRQGLPALRARWIAERGDSEPLADLS
FT                   SDFGRVRAADRALDEMRFPGLQRRPQRARAGANVSQMHYARRGIITPEMEYVAIRENNN
FT                   RRTYVEQLRASGPQGARLAEILCRQHRGQSFGASLPEEVVPDFVRSEVARGRAIIPCNI
FT                   NHPESEPMIIGRNFLTKINANIGNSALGSSIQEEVEKMTWAIRWGGDTVMDLSTGKNIH
FT                   ETREWIIRNSPVPIGTVPIYQALEKVDGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGV
FT                   LLRYVPLTAKRLTGIVSRGGSIMAKWCLAHHKESFLYTHFEEICEIMKAYDVAFSLGDG
FT                   LRPGSIYDANDEAQLGELKTLGELTEVAWRHDVQVMIEGPGHVPMHMIKENMDLQLDSC
FT                   REAPFYTLGPLTTDIAPGYDHITSGIGAAMIGWFGTAMLCYVTPKEHLGLPDKDDVKEG
FT                   IITYKLAAHAADLAKGHSGAQIRDNALSKARFEFRWEDQFNLGLDPEKAREFHDETLPK
FT                   DSAKVAHFCSMCGPHFCSMKITQEVRDFAVAQGLTASEALTRGMEVKAVEFVKAGAEVY
FT                   HKL"
FT                   /protein_id="YP_003165334.1"
FT   misc_feature    33707..35611
FT                   /note="ThiC family; Region: ThiC; cl08031"
FT                   /db_xref="CDD:186739"
FT                   /locus_tag="CAP2UW1_0031"
FT   gene            35676..38537
FT                   /db_xref="GeneID:8402157"
FT                   /locus_tag="CAP2UW1_0032"
FT   CDS_pept        35676..38537
FT                   /locus_tag="CAP2UW1_0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rfr:Rfer_1850 hypothetical protein"
FT                   /db_xref="GI:257091694"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:8402157"
FT                   /translation="MDRQDLAEWSCELDDEEFVVALAALGVLAASGRARELASAVDARA
FT                   REGETPSLVAATRDLSSRFVALDAAGDGLLNWRAPPRRMGRGGGLAKWPPAPVLLMAWG
FT                   DYLAQVAKWRRPGLAGGPRLAVHDGKRQPGRTLSFAQALASPGAGLASVFVADMFAADG
FT                   RTNWRWPFTVASLVDDPLAPELAVALGGGLPAGSPYRFVTVERSDAEVEVLVVGASLGQ
FT                   ALARVLTRDIRLRCCVVIVCGFAQDSPAEAAPLLRSLVSRLAAEGVAVVGAVSEVRELV
FT                   ACVGKFAAGLAANQPIDLALCSAFGGKVLPLLNQDLLALARPERSLDALSHRLRCLPPE
FT                   MRLDLAAESAQQLGVAEKEFAPRARGGRSGGGELGTVRGVPVGAGSLSDLAAQLRAAEA
FT                   QIPNSRYVQQKSFRRIRDRFVAERRGYVVGEPVRVRVLIGPRKAGVSAAPSAFPEDKLE
FT                   RDRSTHRLQLVLHEPQQFATPLLGEILLPRDGDSSEAQFVFTPRAPGDFAARLTVLHRG
FT                   RVLQTVMLCTRVVERAELLAGLRGGIRLEDESRLRQDWSDLGARRRFDMALVFNHTAAE
FT                   QPRLTGVAGQRAWATDLSSIEEPVRSINDLISAVASKVADHEEGLDQGDNPALLVQLAR
FT                   IGADVYSKLYLDQLQQLTAGGLDVGSDAVTHIQVVSTRSDALVPIEFFYDLPPPDADAQ
FT                   VCRQHLQALRDGRCPANCEGAGAPARHVCPMGFWGLKKVIERHFYSAVLGKPDGAELVI
FT                   QAEPTAQRNRLDVRTGALLGYSREVSAEEVQALLETMKGALGGEVGVAEDWAEWKQQVA
FT                   GGPGLLLAFPHNEGRKQDVRLEIGGSFLSTLRLPAEYVRAPGAPAPLVFLLGCDTSSTA
FT                   EDYASHVRYFRQAGAAAVVSTIATVFGRHAVIVGEKIVARLLGAGGEQRLGEIIRDAKR
FT                   EAMRESVPMALCVVAFGDADWRL"
FT                   /protein_id="YP_003165335.1"
FT   gene            38558..39709
FT                   /db_xref="GeneID:8402158"
FT                   /locus_tag="CAP2UW1_0033"
FT   CDS_pept        38558..39709
FT                   /locus_tag="CAP2UW1_0033"
FT                   /gene_family="HOG000125730" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rfr:Rfer_1851 hypothetical protein"
FT                   /db_xref="GI:257091695"
FT                   /db_xref="GeneID:8402158"
FT                   /translation="MAGEFMRIEMLAALHGDCLLVEYGDVRRTRRILIDSGPVGAYEAL
FT                   RGRIERLPKGDRRFELMVLSHVDTDHIEGLIKLFANPRPWPFVVKDVWFNGWRHLEQAH
FT                   GLLGGRQGEFFSALLAKRLDEGCWNGAFKGQAVVVGDAGALPEHVLPGGLKLTLLSPTL
FT                   AKLERMREAWRKDLGDALDPGDLEAAWALLGQQKKYLPGKGLLGSSAQLDSLIEKQSRP
FT                   DDAAANGSSIAFLAEYAGNAGMAASGNEMPGGKSRSCLFLADAHPDAICASVKRLLQAR
FT                   GLARLRVDAVKVAHHGSKANTTDELMSLIESPRFLFSTNGQQFGHPDEEAVGRVIGRSS
FT                   HPSPTLYFNYLSEHNRVWQERQEQFGYKAVFNDGSGSPMVIAL"
FT                   /protein_id="YP_003165336.1"
FT   misc_feature    38597..>38854
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:186000"
FT                   /locus_tag="CAP2UW1_0033"
FT   misc_feature    <38849..>39058
FT                   /note="bifunctional DNA-directed RNA polymerase subunit
FT                   beta/beta'; Reviewed; Region: PRK09603"
FT                   /db_xref="CDD:181983"
FT                   /locus_tag="CAP2UW1_0033"
FT   gene            complement(39686..40495)
FT                   /db_xref="GeneID:8402159"
FT                   /locus_tag="CAP2UW1_0034"
FT   CDS_pept        complement(39686..40495)
FT                   /locus_tag="CAP2UW1_0034"
FT                   /gene_family="HOG000216639" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /transl_table="11"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   dar:Daro_0043 cell wall hydrolase/autolysin"
FT                   /db_xref="GI:257091696"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="GeneID:8402159"
FT                   /translation="MARTQPTATSASQWLNVISILTLLCLSAATPRAAEVALDVGHTLS
FT                   QPGATSARGRPEFAFNAALARRLAAELQARGLAVRPINFDGAIDSLVTRPLQAAGADFF
FT                   LSIHHDSVHADLLQEWRWQGKVQTYTDQYAGFALFVSHDNPDLHTSLSCASAIGARLRR
FT                   TGFLAATHHAEPLAGKPRQPADAANAVYYYDNLVVLYRTTLPAVLFEAGVIKHRAEELA
FT                   LLDPQRQTRMADAIATGIAACLYPCATARRDSPAAGGASASQCNDHR"
FT                   /protein_id="YP_003165337.1"
FT   misc_feature    complement(39770..40495)
FT                   /note="N-acetylmuramoyl-L-alanine amidase [Cell envelope
FT                   biogenesis, outer membrane]; Region: AmiC; COG0860"
FT                   /db_xref="CDD:31201"
FT                   /locus_tag="CAP2UW1_0034"
FT   sig_peptide     complement(40394..40495)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.649 at
FT                   residue 34"
FT                   /locus_tag="CAP2UW1_0034"
FT   misc_feature    complement(39773..40390)
FT                   /note="N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA
FT                   (also known as peptidoglycan aminohydrolase, NAMLA amidase,
FT                   NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28)
FT                   is an autolysin that hydrolyzes the amide bond between
FT                   N-acetylmuramoyl and L-amino...; Region: MurNAc-LAA;
FT                   cd02696"
FT                   /db_xref="CDD:119407"
FT                   /locus_tag="CAP2UW1_0034"
FT   misc_feature    complement(order(39866..39868,40172..40174,40325..40327,
FT                   40370..40372))
FT                   /note="active site"
FT                   /db_xref="CDD:119407"
FT                   /locus_tag="CAP2UW1_0034"
FT   misc_feature    complement(order(40172..40174,40325..40327,40370..40372))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:119407"
FT                   /locus_tag="CAP2UW1_0034"
FT   gene            complement(40497..40829)
FT                   /db_xref="GeneID:8402160"
FT                   /locus_tag="CAP2UW1_0035"
FT   CDS_pept        complement(40497..40829)
FT                   /locus_tag="CAP2UW1_0035"
FT                   /gene_family="HOG000265294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Domain of unknown function DUF1840"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   cti:RALTA_A0101 hypothetical protein"
FT                   /db_xref="GI:257091697"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="GeneID:8402160"
FT                   /translation="MLVKFTSSTSGQIMMFAPVARQLLEIVGKDCNARGVITTEQLPDA
FT                   IHRLREASADAKNPDHAEAVSPDENEDAKESVHVGLGQRAYPLIELLEWTRKEDGYVLW
FT                   EASGDF"
FT                   /protein_id="YP_003165338.1"
FT   misc_feature    complement(40518..40829)
FT                   /note="Domain of unknown function (DUF1840); Region:
FT                   DUF1840; pfam08895"
FT                   /db_xref="CDD:149834"
FT                   /locus_tag="CAP2UW1_0035"
FT   gene            41001..41717
FT                   /db_xref="GeneID:8402161"
FT                   /locus_tag="CAP2UW1_0036"
FT   CDS_pept        41001..41717
FT                   /locus_tag="CAP2UW1_0036"
FT                   /gene_family="HOG000044954" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pseudouridine synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: pseudouridine synthase; KEGG: bmu:Bmul_0808
FT                   pseudouridine synthase"
FT                   /db_xref="GI:257091698"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="GeneID:8402161"
FT                   /translation="MELERLLRSQGFGSRAECRGLVCTGRVSVEGRVCNDPLAQFEPEG
FT                   LSFAVDGQPWAYRRFVYLALNKPAGHECSRRPIHYPSVFSLLPIPLVRRGVQAVGRLDA
FT                   DTTGLLLLTDDGAFIHACTSPRRMVPKVYEVSTRHAVDDGQVAALLSGVVLHDESQAIM
FT                   AAACDRQGERSLRLTVTLGKYHLVKRMVAAAGNRVEALHRVAIGGLALPATLAAGRWTW
FT                   LEAADLALLAPRSLPG"
FT                   /protein_id="YP_003165339.1"
FT   misc_feature    41181..41684
FT                   /note="PseudoU_synth_RsuA: Pseudouridine synthase,
FT                   Escherichia coli RsuA like. This group is comprised of
FT                   eukaryotic and bacterial proteins similar to Escherichia
FT                   coli RsuA. Pseudouridine synthases catalyze the
FT                   isomerization of specific uridines in an RNA...; Region:
FT                   PseudoU_synth_RsuA; cd02553"
FT                   /db_xref="CDD:30010"
FT                   /locus_tag="CAP2UW1_0036"
FT   misc_feature    order(41298..41309,41562..41564)
FT                   /note="active site"
FT                   /db_xref="CDD:30010"
FT                   /locus_tag="CAP2UW1_0036"
FT   misc_feature    order(41397..41399,41553..41564)
FT                   /note="uracil binding; other site"
FT                   /db_xref="CDD:30010"
FT                   /locus_tag="CAP2UW1_0036"
FT   gene            41831..42742
FT                   /db_xref="GeneID:8402162"
FT                   /locus_tag="CAP2UW1_0037"
FT   CDS_pept        41831..42742
FT                   /locus_tag="CAP2UW1_0037"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: eba:ebA2966 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:257091699"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:8402162"
FT                   /translation="MTLTELRYIVTLARERHFGRAAERCHVSQPTLSVALKKVEQRYGV
FT                   VLFERSSADVRLTMIGEQIAGQAERVLEEADRLKEIVVQGKDPLQGPLRLGVIYTIAPY
FT                   LLPQLIPALHARAPRMPLFLQENFTVSLAAQLRRGDLDVIVVALPFGEPGIVSRVVYEE
FT                   PFCVVMPSGHPLAQQSLIDVEQMAAHNLLLLGNGNCFRDQVVQACPQLSAPGGTEGALE
FT                   GSSLETVRYMVASGAGISVVPASAAASWPQDDSLLQSRRFSPPAPVRQVVIAWRATFPR
FT                   PEAIDVLRAAILDAPPPGVLAA"
FT                   /protein_id="YP_003165340.1"
FT   misc_feature    41831..42715
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="CAP2UW1_0037"
FT   misc_feature    41837..42016
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="CAP2UW1_0037"
FT   misc_feature    42101..42706
FT                   /note="The C-terminal substrate-binding domain of the
FT                   LysR-type transcriptional regulator OxyR, a member of the
FT                   type 2 periplasmic binding fold protein superfamily;
FT                   Region: PBP2_OxyR; cd08411"
FT                   /db_xref="CDD:176103"
FT                   /locus_tag="CAP2UW1_0037"
FT   misc_feature    order(42137..42139,42146..42151,42158..42160,42170..42172,
FT                   42194..42208,42491..42493,42500..42505,42512..42514,
FT                   42521..42526,42530..42535)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176103"
FT                   /locus_tag="CAP2UW1_0037"
FT   gene            complement(42825..45422)
FT                   /db_xref="GeneID:8402163"
FT                   /locus_tag="CAP2UW1_0038"
FT   CDS_pept        complement(42825..45422)
FT                   /locus_tag="CAP2UW1_0038"
FT                   /gene_family="HOG000086847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: dar:Daro_0018 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase type IA central domain protein; SMART: DNA
FT                   topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="GI:257091700"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="GeneID:8402163"
FT                   /translation="MSKKLIITEKPSVAADVARALGGFVRHDDYYEGDEYVLSSAIGHL
FT                   LELACPEEYEVKRGKWSFAHLPVIPPHFALQPIAKTESRLKLLVRLIKRKDVAGLINAC
FT                   DAGREGELIFNYINQHAGNAKPVERLWLQSMTPQAIREGFSRLRSGTEMQGLGDAAVCR
FT                   SESDWLVGINGTRAMTAFNSKTGGFHLTTVGRVQTPTLALMVDREDRIRKFVARAYWEL
FT                   DGVFACAAGDYRGRWFDENFKGKDDDEHARADRLWDESRALALQNKCADQDGDVSEESK
FT                   ASTQLSPLLFDLTSLQREANGRFGFSAKATLGLAQALYEKHKILTYPRTDSRALPEDYR
FT                   QTVLSTLSMLTGEGVGKGHDEQTLARYAPFAGRILASNWVVPNKRIFNNAKVSDHFAII
FT                   PTLQAPKHLSEPEMKLYDMVVKRFLAVFHPAAEYLITTRITRVAGEPFKTEGKVLVNPG
FT                   WLAVYGREGQEGEEGNLVAVQAGERVHASEMLLSAHQTRPPARYSEASLLTAMEGAGKA
FT                   MDDEELRAAMAGRGLGTPATRAQIIENLLAEQYLQREGRELQPTAKAFSLMTLLNGLGI
FT                   PELTAPELTGEWEWKLARMERGELARTAFMKEIAAMTQRIVDRAKSYDSDTIPGDFGEL
FT                   STPCPKCGALIKETYKKFQCQACDFSLWKIVAGRQFEASEIEELLTRRRIGPLSGFRNK
FT                   MGRPFNAIIQLNADNSPEFDFGQGSAGADGPAEEVDFSQSETLGPCPKCGASVFEHGMA
FT                   YVCERSQGSAKTCDFRSGKVILQQTVEAEQMQKLLSSGRTDLLRNFVSARTRRKFSAYL
FT                   VRGADGKVGFEFEKREPRTPAKKSRATPTSEPSDAATPTSGTTTRSRKKASSS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165341.1"
FT   misc_feature    complement(42894..45422)
FT                   /note="DNA topoisomerase III; Validated; Region: PRK08173"
FT                   /db_xref="CDD:181267"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(44982..45416)
FT                   /note="TOPRIM_TopoIA_TopoIII: The topoisomerase-primase
FT                   (TORPIM) domain found in members of the type IA family of
FT                   DNA topoisomerases (Topo IA) similar to topoisomerase III.
FT                   Type IA DNA topoisomerases remove (relax) negative
FT                   supercoils in the DNA by:...; Region:
FT                   TOPRIM_TopoIA_TopoIII; cd03362"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(45096..45098,45102..45104,45108..45110,
FT                   45384..45386,45393..45398))
FT                   /note="active site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(45066..45071,45075..45080,45099..45101,
FT                   45105..45107,45375..45377))
FT                   /note="putative interdomain interaction site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(45102..45104,45108..45110))
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(45099..45101)
FT                   /note="putative nucleotide binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(43572..44960)
FT                   /note="DNA Topoisomerase, subtype IA; DNA-binding,
FT                   ATP-binding and catalytic domain of bacterial DNA
FT                   topoisomerases I and III, and eukaryotic DNA topoisomerase
FT                   III and eubacterial and archael reverse gyrases.
FT                   Topoisomerases clevage single or double stranded...;
FT                   Region: TOP1Ac; cd00186"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(44790..44846,44856..44861,44880..44960))
FT                   /note="domain I; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(43779..43784,43794..43796,43800..43805,
FT                   43812..43817,44436..44438,44463..44465,44475..44477,
FT                   44898..44900,44910..44912,44922..44924,44931..44936))
FT                   /note="DNA binding groove"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(43707..43709,44805..44807,44817..44819))
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(43932..43964,44034..44090,44094..44138,
FT                   44565..44597,44742..44777))
FT                   /note="domain II; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(44139..44201,44217..44243,44370..44447,
FT                   44451..44540,44544..44564))
FT                   /note="domain III; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(43749..43751,43815..43817,43821..43823,
FT                   44160..44162,44172..44174,44181..44183,44238..44240,
FT                   44511..44519,44529..44531))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(44238..44240,44436..44438,44442..44444))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   misc_feature    complement(order(43572..43688,43707..43751,43761..43838,
FT                   43887..43931))
FT                   /note="domain IV; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="CAP2UW1_0038"
FT   gene            complement(45566..46015)
FT                   /db_xref="GeneID:8402164"
FT                   /locus_tag="CAP2UW1_0039"
FT   CDS_pept        complement(45566..46015)
FT                   /locus_tag="CAP2UW1_0039"
FT                   /gene_family="HOG000137865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF494"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   eba:ebA2962 hypothetical protein"
FT                   /db_xref="GI:257091701"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="GeneID:8402164"
FT                   /translation="MIDILVYLFANYHDFSARPKTRTLRRRLSAVGFNDEAIGVALRWL
FT                   DGLKGAPLLDWPDGHRAMRIYVPEEQRKLGADCLGFIAFLEASGLLSPGMRELVVERAM
FT                   MLDDDPVPIGKFKIIVLMVLWSREQDLEPLIVEELLDAGDAHPLH"
FT                   /protein_id="YP_003165342.1"
FT   misc_feature    complement(45569..46015)
FT                   /note="Protein of unknown function (DUF494); Region:
FT                   DUF494; cl01103"
FT                   /db_xref="CDD:186336"
FT                   /locus_tag="CAP2UW1_0039"
FT   gene            complement(46028..47119)
FT                   /db_xref="GeneID:8402165"
FT                   /locus_tag="CAP2UW1_0040"
FT   CDS_pept        complement(46028..47119)
FT                   /locus_tag="CAP2UW1_0040"
FT                   /gene_family="HOG000003906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA protecting protein DprA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: dar:Daro_0019 smf protein"
FT                   /db_xref="GI:257091702"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="GeneID:8402165"
FT                   /translation="MDAAESSAGWLRLTLVPGVGGESQRKLLKAFGLPEAIFTAGRSAL
FT                   GDVIGDRTARLLLDTDNRAAVDRALAWANGTNQHLVCLADPEYPQALLQIPDPPTLLYV
FT                   RGRLSLLNQPALAVVGSRNPTPQGRGNAERFAAAFAEAGLGVVSGLALGIDAAAHRGAL
FT                   NATGNTIAFIGTGIDRIYPAANQQLAFDIAARGAIASEFPLATPPAAANFPRRNRLISG
FT                   ISRGVLVVEATTESGSLITARLAAEQGREVFAIPGSIHSPQSRGCHRLIKQGAKLAEAV
FT                   ADVIEEIGWASAPADRPASATADAAEAGSLLLAMGFDPCSLDELTQRSGLTADAVSVIL
FT                   LHLELDGQVACLPGGHYQRISQA"
FT                   /protein_id="YP_003165343.1"
FT   misc_feature    complement(46040..47092)
FT                   /note="Predicted Rossmann fold nucleotide-binding protein
FT                   involved in DNA uptake [DNA replication, recombination, and
FT                   repair / Intracellular trafficking and secretion]; Region:
FT                   Smf; COG0758"
FT                   /db_xref="CDD:31101"
FT                   /locus_tag="CAP2UW1_0040"
FT   misc_feature    complement(46289..46885)
FT                   /note="DNA recombination-mediator protein A; Region:
FT                   DNA_processg_A; cl00695"
FT                   /db_xref="CDD:153941"
FT                   /locus_tag="CAP2UW1_0040"
FT   gene            complement(47122..48141)
FT                   /db_xref="GeneID:8402166"
FT                   /locus_tag="CAP2UW1_0041"
FT   CDS_pept        complement(47122..48141)
FT                   /locus_tag="CAP2UW1_0041"
FT                   /gene_family="HOG000270067" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   dar:Daro_0020 peptidoglycan-binding LysM"
FT                   /db_xref="GI:257091703"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="GeneID:8402166"
FT                   /translation="MTRIMFAFILAMASAALSSVSAQELQLAAGAPERHVVLPGDTLWA
FT                   ISGKFLKEPWRWPEIWRMNREEIRNPHRIFPGDVIVLERDARGDPRLRLQRARLVPQVY
FT                   SEAIEESIPAIPPNVIRPFLSDPLIVEANALDSAARIIATQQDRVFIGNGDLAYVVNAD
FT                   PDKVAWQIYRSGKPLNDPETNEVLGYEAYYLGTARQLEPGNPATFQVISMKEEIGRGDR
FT                   LLPAIRPPLVAYVPHKPDFSVDGRVISVYGGVDAAGRGSIVSINRGAADGIEIGHVLAL
FT                   QRNRTAVAREENDRKETVQIPVLRVGLLFVFRTFQRISYGLIVQSEGTVEVNDFARTP"
FT                   /protein_id="YP_003165344.1"
FT   sig_peptide     complement(48073..48141)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_0041"
FT   misc_feature    complement(47896..48039)
FT                   /note="Lysin domain, found in a variety of enzymes involved
FT                   in bacterial cell wall degradation. This domain may have a
FT                   general peptidoglycan binding function; Region: LysM;
FT                   cl00107"
FT                   /db_xref="CDD:153515"
FT                   /locus_tag="CAP2UW1_0041"
FT   gene            48319..48822
FT                   /db_xref="GeneID:8402167"
FT                   /locus_tag="CAP2UW1_0042"
FT   CDS_pept        48319..48822
FT                   /locus_tag="CAP2UW1_0042"
FT                   /gene_family="HOG000243509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: dar:Daro_0021 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="GI:257091704"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="GeneID:8402167"
FT                   /translation="MSLLPILRFPDPRLRKVAARVDKIDDGIRRLARDMAETMYEAPGI
FT                   GLAATQVDVHARVIVVDASETRDQLLTLINPEILQQDGLQVCEEGCLSVPGVYDKVERA
FT                   EHVVVRYQDLDGAEQTVDATGLLAVCLQHEIDHLQGRVFVEHLSQLKQLRIRNKLAKQA
FT                   RITA"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165345.1"
FT   misc_feature    48334..48747
FT                   /note="Polypeptide or peptide deformylase; a family of
FT                   metalloenzymes that catalyzes the removal of the N-terminal
FT                   formyl group in a growing polypeptide chain following
FT                   translation initiation during protein synthesis in
FT                   prokaryotes. These enzymes utilize Fe...; Region:
FT                   Pep_deformylase; cd00487"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="CAP2UW1_0042"
FT   misc_feature    order(48448..48456,48469..48471,48586..48594,48715..48720,
FT                   48727..48729)
FT                   /note="active site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="CAP2UW1_0042"
FT   misc_feature    order(48454..48456,48469..48471,48592..48594,48718..48720)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="CAP2UW1_0042"
FT   misc_feature    order(48589..48591,48715..48717,48727..48729)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29602"
FT                   /locus_tag="CAP2UW1_0042"
FT   gene            48819..49745
FT                   /db_xref="GeneID:8402168"
FT                   /locus_tag="CAP2UW1_0043"
FT   CDS_pept        48819..49745
FT                   /locus_tag="CAP2UW1_0043"
FT                   /gene_family="HOG000261177" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: dar:Daro_0022
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="GI:257091705"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="GeneID:8402168"
FT                   /translation="MRLVFAGTPEFAALALRQILAAGHQVVLVLTQPDRPSGRGMALRA
FT                   SPVKELANAAGLEVFQPPTLRDALVQQRIRAAGAEAMVVAAYGLILPQAVLDMPSHGCI
FT                   NIHASLLPRWRGAAPIQRAILAGDQETGVSIMQMEAGLDSGPVLLSASVPISDTDTAAS
FT                   LHETLALLGARLVVDVLARLPLPASPQPEVGITYAAKIDKAEASLDWHRPAWQLARQVR
FT                   AFNPFPGSTCCLDDVPLKVWRAEAVAGDGRPGMVLRVERDGVVVACGEQALRLGELQKA
FT                   GGRRLSAAQYLAGTALSPGACCALSGS"
FT                   /protein_id="YP_003165346.1"
FT   misc_feature    48819..49730
FT                   /note="methionyl-tRNA formyltransferase; Reviewed; Region:
FT                   fmt; PRK00005"
FT                   /db_xref="CDD:178787"
FT                   /locus_tag="CAP2UW1_0043"
FT   misc_feature    48819..49358
FT                   /note="Formyl transferase; Region: Formyl_trans_N; cl00395"
FT                   /db_xref="CDD:185966"
FT                   /locus_tag="CAP2UW1_0043"
FT   misc_feature    49416..49700
FT                   /note="Formyl transferase, C-terminal domain; Region:
FT                   Formyl_trans_C; pfam02911"
FT                   /db_xref="CDD:145851"
FT                   /locus_tag="CAP2UW1_0043"
FT   gene            49818..50666
FT                   /db_xref="GeneID:8402169"
FT                   /locus_tag="CAP2UW1_0044"
FT   CDS_pept        49818..50666
FT                   /locus_tag="CAP2UW1_0044"
FT                   /gene_family="HOG000227301" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase M48 Ste24p"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: dar:Daro_0023 heat
FT                   shock protein HtpX"
FT                   /db_xref="GI:257091706"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="GeneID:8402169"
FT                   /translation="MFANWLKTSILMAAIVALFGVIGGFVGGKSGMLLALLFGGAMNVF
FT                   AYWFSDKMVLKMYNAREVDASSAPQFYGMVRELAQRAGLPMPRVYLIDEGQPNAFATGR
FT                   NPDNAAVAATSGILQLLSAREIRGVMAHELAHVRHRDILISTISATMAGAISALANFAV
FT                   FFGGRDSEGRPSNPLAGILVALLAPLAASLIQMAISRAREFEADRGGAEICGDPNALAD
FT                   ALAKIDAYARGIPMAPAEAHPETAQMMIMNPLSGGGIAGLFSTHPATAERVARLRAMGR
FT                   G"
FT                   /protein_id="YP_003165347.1"
FT   sig_peptide     49818..49904
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.692 at
FT                   residue 29"
FT                   /locus_tag="CAP2UW1_0044"
FT   misc_feature    49827..50663
FT                   /note="Peptidase family M48; Region: Peptidase_M48;
FT                   cl12018"
FT                   /db_xref="CDD:187163"
FT                   /locus_tag="CAP2UW1_0044"
FT   gene            complement(50709..51671)
FT                   /db_xref="GeneID:8402170"
FT                   /locus_tag="CAP2UW1_0045"
FT   CDS_pept        complement(50709..51671)
FT                   /locus_tag="CAP2UW1_0045"
FT                   /gene_family="HOG000133846" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_0027 hypothetical protein"
FT                   /db_xref="GI:257091707"
FT                   /db_xref="GeneID:8402170"
FT                   /translation="MTARPCRRTWRLRFGACLLLLVAAPALAWNAAGHRISAMIAWESM
FT                   DAGTKSAVGQLLRQHPDYERWQARAHGGDPELTAFLEASTWPDDIRKDRRFYTTGREEP
FT                   TATLPGFPDMERRLHWHYVDRPVNPGAGTGPAAGVIDRQLAVLARIVGDRQATMAERAY
FT                   ALPWLIHLVGDAHQPLHAASRYGPDGQSDNGGNLVSIVNPFAARYTSMSLHRYWDDLPG
FT                   PPWLRDGRLASAARSLAALHRPPTSPGTPEQWLDESWRLARERVYPPGDDAVPTISATF
FT                   HEDALAIAGRRVAEAGYRLADLLQRLLHSGPRREDRNDR"
FT                   /protein_id="YP_003165348.1"
FT   sig_peptide     complement(51585..51671)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 29"
FT                   /locus_tag="CAP2UW1_0045"
FT   misc_feature    complement(50748..51575)
FT                   /note="S1/P1 Nuclease; Region: S1-P1_nuclease; pfam02265"
FT                   /db_xref="CDD:145426"
FT                   /locus_tag="CAP2UW1_0045"
FT   gene            complement(51661..52569)
FT                   /db_xref="GeneID:8402171"
FT                   /locus_tag="CAP2UW1_0046"
FT   CDS_pept        complement(51661..52569)
FT                   /locus_tag="CAP2UW1_0046"
FT                   /gene_family="HOG000069673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   tbd:Tbd_1114 cation efflux protein"
FT                   /db_xref="GI:257091708"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="GeneID:8402171"
FT                   /translation="MRRMTSSSLKPFAWLSIGAALATIALKGLAWMMTGSVGLLSDALE
FT                   SLVNLAGGAMALAMLSIAERPEDEGHAFGHGKAEYFSSGFEGLLILFAALAIAFAAIER
FT                   LLYPKPLEQLGLGLVVSTLASLINLVVGSVLLRAGKRHRSITLEADAHHLLTDVWTSVG
FT                   VIVGLTAVALTGWLWLDPTLALLVATNIVWTGWRLLQRSAVGLMDGSLPPEEHALVLAI
FT                   LERYRALGIEFHAVRTRESGTRRFISLHVLVPGSWTISRGHQLVEELEREVRQTLSHAS
FT                   VFTHLEPLEDPVSQEDIALDR"
FT                   /protein_id="YP_003165349.1"
FT   sig_peptide     complement(52477..52569)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.655 at
FT                   residue 31"
FT                   /locus_tag="CAP2UW1_0046"
FT   misc_feature    complement(51682..52533)
FT                   /note="Cation efflux family; Region: Cation_efflux;
FT                   cl00316"
FT                   /db_xref="CDD:185899"
FT                   /locus_tag="CAP2UW1_0046"
FT   gene            52693..54021
FT                   /db_xref="GeneID:8402172"
FT                   /locus_tag="CAP2UW1_0047"
FT   CDS_pept        52693..54021
FT                   /locus_tag="CAP2UW1_0047"
FT                   /gene_family="HOG000037300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sun protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; KEGG: dar:Daro_0028 Fmu, rRNA SAM-dependent
FT                   methyltransferase"
FT                   /db_xref="GI:257091709"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006174"
FT                   /db_xref="GeneID:8402172"
FT                   /translation="MRVRKPAAVVKGPPRRKPGPPPSRLPADSLGLSLLLAARVIAAVR
FT                   AGQSLTQALRPLSAAAPAARAAAQDVAYGTLRRYGCGEFILARLLTKPLSHTETEALLL
FT                   AALFRLHTRPEAAYMVVDQAVAAAGEMTGGVFKGLVNGLLRSYLRQRESLAAAMAGDDE
FT                   AVQQHPAWWLARLRRAYPEHWQEIVAAGNGPPPMTLRVNRRRATSEAYAARLLEAGSSA
FT                   RQVAANALLLAKPVTVDALPGFADGLVSIQDAGAQRAAQLLLPVAGERILDACAAPGGK
FT                   AAHLLEAADIDLLALDIDATRTRRIEDNLRRLGLVAKVGVADCRASGDWWDGLPFDAIL
FT                   ADVPCSASGVVRRHPDIKYLRRESDIRRFALLQADLLDQLWPLLKPGGRLLYATCSVFP
FT                   EENEGQIDAFLVRQPTARRLVEERLLPREEHDGFYYALLRKAP"
FT                   /protein_id="YP_003165350.1"
FT   misc_feature    52897..54015
FT                   /note="16S rRNA methyltransferase B; Provisional; Region:
FT                   PRK10901"
FT                   /db_xref="CDD:182822"
FT                   /locus_tag="CAP2UW1_0047"
FT   misc_feature    <52897..53142
FT                   /note="RNA binding domain of NusB (N protein-Utilization
FT                   Substance B) and Sun (also known as RrmB or Fmu) proteins.
FT                   This family includes two orthologous groups exemplified by
FT                   the transcription termination factor NusB and the
FT                   N-terminal domain of the rRNA-...; Region: NusB_Sun;
FT                   cl00223"
FT                   /db_xref="CDD:185841"
FT                   /locus_tag="CAP2UW1_0047"
FT   misc_feature    53395..53940
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="CAP2UW1_0047"
FT   gene            53996..54616
FT                   /db_xref="GeneID:8402173"
FT                   /locus_tag="CAP2UW1_0048"
FT   CDS_pept        53996..54616
FT                   /locus_tag="CAP2UW1_0048"
FT                   /gene_family="HOG000266169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_0029 probable proline rich signal
FT                   peptide protein"
FT                   /db_xref="GI:257091710"
FT                   /db_xref="GeneID:8402173"
FT                   /translation="MRCCGKLLSSFLVGLFILIASSSTQAADISIRNPQLSAGDEGYVL
FT                   SADFTINLNARLEEVVAKGVALYFVVDFELSRSRWYWLDEQVVGRSQSYQLSYHALTRQ
FT                   YRLSSGALHQSFATLDEALRILTRLRNWPVLDKGSLAAGQTYQLALRMRLDLTQMPKTF
FT                   QVNALANRDWNLTSEWARWNLTPGDVSSLGVAATLAPATGESK"
FT                   /protein_id="YP_003165351.1"
FT   sig_peptide     53996..54076
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT                   /locus_tag="CAP2UW1_0048"
FT   gene            54613..56766
FT                   /db_xref="GeneID:8402174"
FT                   /locus_tag="CAP2UW1_0049"
FT   CDS_pept        54613..56766
FT                   /locus_tag="CAP2UW1_0049"
FT                   /gene_family="HOG000266158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; PAS fold-4 domain protein; KEGG:
FT                   dar:Daro_0030 multi-sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="GI:257091711"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="GeneID:8402174"
FT                   /translation="MKSLIVAAASFGGILLFLLASASANTALFARHYPWLLGLNAIVAL
FT                   SLLALIAWQLRILWGEHRARVFGSRLKLRLMLMFGLMAVVPGVLIYAVSVQFVTKSIDT
FT                   WFDVRVEKALEAGLNLGRSALDSLLADLAAKGQSMALELADRSEAQRRLELNRLREQHG
FT                   VQSAALFSTTGTLVATATGELATLLPAQPAPEQLRRALAERRLAVIESHSEKDLTLRVL
FT                   VAVTPPGLGIETRILQLTDPVPTSLAQNADSVQAVYADYQELSLGREGLTRIYAMTLTL
FT                   TVLLALFTAIALAFVLARRLSAPLSILAEGTQAVAAGDYTPRQAVYSRDELGVLTRSFK
FT                   QMTSQLDEARRDNERHRAELEAARAYLESILANLSAGVLVFDHRFVLRTFNEGALTILD
FT                   DDFSDLLGHPVDAWPRQETLGQAIRSAFDTHASSEWQEQIELDHSGGLPQILLLRGTQL
FT                   PAGSHGGYVVVFDDVTRLIAAQRSAAWGEVARRLAHEIKNPLTPIQLSAERLQMKLADR
FT                   LAGADAQMLARSTQTIITQVQAMKRMVNDFSDYARLPAPELAAVDLNALISEVLGLYET
FT                   SRATIKLKLAPRLPLVWGDVTQLRQIIHNLLRNAEDAQEALESPCIGISTQCTDSMAEM
FT                   VVTDHGPGFPPEILARVCEPYVTTKARGTGLGLAIVKKIVDEHHGRIRINNRQRVGAEV
FT                   SIMLPLVSQPSARRHPSKLSSEA"
FT                   /protein_id="YP_003165352.1"
FT   sig_peptide     54613..54687
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.471 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    54622..56712
FT                   /note="Signal transduction histidine kinase involved in
FT                   nitrogen fixation and metabolism regulation [Signal
FT                   transduction mechanisms]; Region: NtrY; COG5000"
FT                   /db_xref="CDD:34605"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    55507..55665
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    56056..56268
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    order(56074..56076,56086..56088,56098..56100,56107..56109,
FT                   56119..56121,56128..56130,56197..56199,56209..56211,
FT                   56218..56220,56230..56232,56239..56241,56251..56253)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    56092..56094
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    56407..56706
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    order(56425..56427,56437..56439,56446..56448,56521..56523,
FT                   56527..56529,56533..56535,56539..56544,56605..56616,
FT                   56662..56664,56668..56670,56683..56688,56692..56694)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    56437..56439
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0049"
FT   misc_feature    order(56533..56535,56539..56541,56605..56607,56611..56613)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0049"
FT   gene            56769..58025
FT                   /db_xref="GeneID:8402175"
FT                   /locus_tag="CAP2UW1_0050"
FT   CDS_pept        56769..58025
FT                   /locus_tag="CAP2UW1_0050"
FT                   /gene_family="HOG000058489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative two component, sigma54 specific,
FT                   transcriptional regulator, Fis family"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   dar:Daro_0031 helix-turn-helix, fis-type"
FT                   /db_xref="GI:257091712"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="GeneID:8402175"
FT                   /translation="MAQVLIVDDEMGIRELLSEILADEGHSVWLAENAAVARRMRAEKR
FT                   PDLVLLDIWMPDTDGISLLKEWSAGGLLTMPVVMMSGHGTIDSAVEATRIGATDFLEKP
FT                   IALQKLLATVKKALKHEAVLQKRPLTLDAFTRSPLLKDLKRRLEQAAAKTSVLLLKSAS
FT                   GSIAEICARTLQTHRTPWLDLSTLSTPLTQEMLQNAGGGIVFIADLAQFGKLQQMNLVF
FT                   AIERLERQNLQLVAASSRSLSALVDSGWDPLLVNRLGEVWVALPQISGHADDVPEIATL
FT                   LLADLAERGEVPLRHFSSGAQNALRLHRWQGEWAELLTTVKNLALSALDEEISADDVAR
FT                   TLQTEASGAATPLAALFFDLPLREAREGFERLYFEYHLSSERGNMTRLAEKTGLERTHL
FT                   YRKLRQLGLNIGRRSDERE"
FT                   /protein_id="YP_003165353.1"
FT   misc_feature    56769..58016
FT                   /note="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains [Signal
FT                   transduction mechanisms]; Region: AtoC; COG2204"
FT                   /db_xref="CDD:32386"
FT                   /locus_tag="CAP2UW1_0050"
FT   misc_feature    56781..57122
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0050"
FT   misc_feature    order(56790..56795,56922..56924,56946..56948,57009..57011,
FT                   57066..57068,57075..57080)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0050"
FT   misc_feature    56922..56924
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0050"
FT   misc_feature    order(56931..56936,56940..56948)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0050"
FT   misc_feature    57075..57083
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0050"
FT   gene            58063..59493
FT                   /db_xref="GeneID:8402176"
FT                   /locus_tag="CAP2UW1_0051"
FT   CDS_pept        58063..59493
FT                   /locus_tag="CAP2UW1_0051"
FT                   /gene_family="HOG000227130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TrkA-N domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: azo:azo3981 potassium transporter peripheral membrane
FT                   component"
FT                   /db_xref="GI:257091713"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="GeneID:8402176"
FT                   /translation="MRIVILGAGQVGASVAESLVSENNDITIVDSDQDRLAYLQDRLDL
FT                   RTVTGNAAYPSVLASAGLDDADLLIAVTQSDQTNLVACKVAHSVFNVPARIARLRARDF
FT                   LESEKLLAPENFAVDYALCPEQVITEYIARLVEFPEALQVLNFGDGRLVLVGLRAYAGG
FT                   LLVGSPIKEMRGHLPPEIDGRIAAIYRRDGAITPTGETIIEDGDEVFLLAAEEHIRAVM
FT                   RELRRSVEPVRRVMIAGGGNIGHRVAQALEGKCEVKLIEVSRRRAEFVATSLKAVLVLH
FT                   GDATDEELLQQEAIDEMDLFLALTNDDEDNIMAASLAKKMGSKRVVALINRRAYADLVQ
FT                   GGPIDIAISPAQVSIGTLLTYVRHGDVAQVHSLRRGAAEALEVVAHGDQKTSRVVGRRI
FT                   CDVPTIEGAFIAAVVRDLDKTQDVGFLGLAKKKQRGRVLIAHKDVVIQTDDHVIVFCLD
FT                   KKVVKQVEKLFAVGFHFF"
FT                   /protein_id="YP_003165354.1"
FT   misc_feature    58063..59481
FT                   /note="potassium transporter peripheral membrane component;
FT                   Reviewed; Region: trkA; PRK09496"
FT                   /db_xref="CDD:181909"
FT                   /locus_tag="CAP2UW1_0051"
FT   misc_feature    58069..58380
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0051"
FT   misc_feature    58522..58740
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:186825"
FT                   /locus_tag="CAP2UW1_0051"
FT   misc_feature    58765..59112
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0051"
FT   gene            59503..60957
FT                   /db_xref="GeneID:8402177"
FT                   /locus_tag="CAP2UW1_0052"
FT   CDS_pept        59503..60957
FT                   /locus_tag="CAP2UW1_0052"
FT                   /gene_family="HOG000225541" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cation transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: cation transporter; KEGG: tbd:Tbd_0022 trk
FT                   system potassium uptake membrane protein"
FT                   /db_xref="GI:257091714"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="GeneID:8402177"
FT                   /translation="MQRYYPVIRVLSMVIVMFGLTMLVPWGLSWFMHDGAESAFDEAVL
FT                   LTVGTGAGLWYATRKEKRDLTIRDGFLMVALVWTVLPVYAALPLVIQLNASFTDAYFEA
FT                   VSGLTTTGATVFEGLDNLPVSINFWRTQLVWLGGMGLIVLAVAILPLLGIGGRQMFKAE
FT                   TPGPMKDSKMTPRMAETAKGLWVVYTLISVCCVLGYQWAGMTWLDAIMHMFATMGLGGF
FT                   SSHDASYGYFNSPLIEAVAILFMLIAGCNFATHYVVLSGRSLRPYATDPEAGMFLLVTL
FT                   GSVVGIAIFLDVHEVYPTFSEALRFSAFNVVSIATTTGFANTDYALWPFFAPLWMLFLS
FT                   SFATSAGSTGGGIKMIRAIVLYKQVYRELARAMHPNAVHPVKVGNEVVPPNILFAVLAF
FT                   GFMYMVCIASMTLLLSFSGLEIITAFTAVVASINNTGPGLGQVGPANNFSVLTDFQTWV
FT                   CTFAMLIGRLEIFTLLVVLTPAFWRK"
FT                   /protein_id="YP_003165355.1"
FT   misc_feature    59506..60954
FT                   /note="Trk-type K+ transport systems, membrane components
FT                   [Inorganic ion transport and metabolism]; Region: TrkG;
FT                   COG0168"
FT                   /db_xref="CDD:30517"
FT                   /locus_tag="CAP2UW1_0052"
FT   misc_feature    59521..60954
FT                   /note="Cation transport protein; Region: TrkH; cl10514"
FT                   /db_xref="CDD:187005"
FT                   /locus_tag="CAP2UW1_0052"
FT   gene            complement(60997..62457)
FT                   /db_xref="GeneID:8402178"
FT                   /locus_tag="CAP2UW1_0053"
FT   CDS_pept        complement(60997..62457)
FT                   /locus_tag="CAP2UW1_0053"
FT                   /gene_family="HOG000225541" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cation transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: cation transporter; KEGG: eba:ebA2824 cation
FT                   transport protein"
FT                   /db_xref="GI:257091715"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="GeneID:8402178"
FT                   /translation="MIKRFAPVLFVLGILILGFGFLMLVPLSLSWLSADGAHGAYDEAV
FT                   LITMASGALLSLSVRRQKREIRVRESFLLVALIWSLLPAFGALPLYLHIKELSWTDAYF
FT                   EAVSGLTATGATVLSGLDTLPLSINFWRTFMHWIGGLGVVVLAVAILPMLGFGGRGMLK
FT                   AETPGPMKDAKITPRITETAKGLWVVYVILTISCGVSLYQVGMEPWDALMHAFSIMGLG
FT                   GFSTKDASLGHFDSLDIELVVIFFALLAGINFSTHFLVLSQRSLRAYRFDIEAHYFLGF
FT                   LALSSVALALYLWPDDVYEDFLTTLRYVAFHSVSLATSLGFATTDYAQWPLFAQLWILF
FT                   LGSFVACSGSAGGGIKMIRAVVLYKQVSRELMRAMHPRGLQTVRFGATVVPDPVLHSIL
FT                   GFMFIYVVTIVILTLLLIATRLDVITAFSAVVACINNTGPGLNLVGPSTTYAVLTDFQT
FT                   WVCTWAMLLGRLEIFTLLVILMPAFWRR"
FT                   /protein_id="YP_003165356.1"
FT   sig_peptide     complement(62365..62457)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.366 at
FT                   residue 31"
FT                   /locus_tag="CAP2UW1_0053"
FT   misc_feature    complement(61003..62355)
FT                   /note="Cation transport protein; Region: TrkH; cl10514"
FT                   /db_xref="CDD:187005"
FT                   /locus_tag="CAP2UW1_0053"
FT   misc_feature    complement(61051..62205)
FT                   /note="potassium uptake protein, TrkH family; Region: 2a38;
FT                   TIGR00933"
FT                   /db_xref="CDD:162118"
FT                   /locus_tag="CAP2UW1_0053"
FT   gene            62931..64430
FT                   /db_xref="GeneID:8402179"
FT                   /locus_tag="CAP2UW1_0054"
FT   CDS_pept        62931..64430
FT                   /locus_tag="CAP2UW1_0054"
FT                   /gene_family="HOG000226024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1538"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1538; KEGG:
FT                   sun:SUN_1865 hypothetical protein"
FT                   /db_xref="GI:257091716"
FT                   /db_xref="InterPro:IPR011435"
FT                   /db_xref="GeneID:8402179"
FT                   /translation="MGSLLRIARELMREAARDLAPTLVVVAIFQVFFIQRMPDSPAGLI
FT                   GGFAAVLLGLALFVKGLDAAIFPAGETMAFDFARRGSFLWLMLFAFCISFASVAAEPAL
FT                   MAVAYKAEAVSGGSMGALTLRMVAALGVGLAVVVGVWRIVLGHSIGNYLIPGYLIVIAL
FT                   TVFSPPQLVGLAFDSGGVVASTVTAPLLTALGVGLATSIRGRNPMLDGFGLIAFGALAP
FT                   MIIIQIYGIVFFVPAAAGTAVVMMPTDDQHQYAALELLFDFLIMVRNLLPIIVVVLFSS
FT                   FVILRRPLADPKGLAVGMVLVAVGLFLFDEGLQVGLFPLGDEMTKGLMGDGVAMWAVYL
FT                   YGFLIGFATTMAEPALIALSIKADEVSLGQLKGIWLRSLVSIGVGIGIVIGCARIIDGI
FT                   NIAYWLIPGYLLVLAMTKVAPRFIVPIAYDCGGVTTSTVTVPLVTALGVGLAERTPGRD
FT                   PMIDGFGLIAFASLLPMIIVMSYGILASWLMSRKSAKEKTR"
FT                   /protein_id="YP_003165357.1"
FT   misc_feature    63117..63629
FT                   /note="Protein of unknown function (DUF1538); Region:
FT                   DUF1538; pfam07556"
FT                   /db_xref="CDD:148909"
FT                   /locus_tag="CAP2UW1_0054"
FT   misc_feature    63861..64385
FT                   /note="Protein of unknown function (DUF1538); Region:
FT                   DUF1538; pfam07556"
FT                   /db_xref="CDD:148909"
FT                   /locus_tag="CAP2UW1_0054"
FT   gene            64427..64774
FT                   /db_xref="GeneID:8402180"
FT                   /locus_tag="CAP2UW1_0055"
FT   CDS_pept        64427..64774
FT                   /locus_tag="CAP2UW1_0055"
FT                   /gene_family="HOG000003374" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aeh:Mlg_0660 hypothetical protein"
FT                   /db_xref="GI:257091717"
FT                   /db_xref="GeneID:8402180"
FT                   /translation="MKFSAVVLIIPEEDENRAVGILKHAGATGLTILKGKGLRHNERKT
FT                   FLGLGLERKESVLLCVVEKQLAMRILRSVKTEMKLDEPGGGLAFSLPLGSVVGIGLAQM
FT                   QAFRREVEEDL"
FT                   /protein_id="YP_003165358.1"
FT   gene            64849..65244
FT                   /db_xref="GeneID:8402181"
FT                   /locus_tag="CAP2UW1_0056"
FT   CDS_pept        64849..65244
FT                   /locus_tag="CAP2UW1_0056"
FT                   /gene_family="HOG000187907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   aeh:Mlg_0661 putative signal-transduction protein with CBS
FT                   domains"
FT                   /db_xref="GI:257091718"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:8402181"
FT                   /translation="MLVAGIMKKDVVTISPLATVREALMMMKARGVRSLVVEKRHSGDA
FT                   YGLIAYRDVAKSVIAEDGDIDLLNVYDIAQKPALQVSQHLEIRYLARLMIQYSVKRVLV
FT                   IDNNELQGFVSDTDVVTSLIERALRDR"
FT                   /protein_id="YP_003165359.1"
FT   misc_feature    64855..65208
FT                   /note="FOG: CBS domain [General function prediction only];
FT                   Region: COG0517"
FT                   /db_xref="CDD:30863"
FT                   /locus_tag="CAP2UW1_0056"
FT   misc_feature    64873..65208
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so-...; Region: CBS_pair_17; cd04630"
FT                   /db_xref="CDD:73128"
FT                   /locus_tag="CAP2UW1_0056"
FT   gene            65257..65694
FT                   /db_xref="GeneID:8402182"
FT                   /locus_tag="CAP2UW1_0057"
FT   CDS_pept        65257..65694
FT                   /locus_tag="CAP2UW1_0057"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091719"
FT                   /db_xref="GeneID:8402182"
FT                   /translation="MEKIVRRYAAHFPRWCQAFGDHLPDPGGEGRAVEWLVGEGCVGVI
FT                   VLPEVRRLLMHELLGPQKPHLEFRQRSLSLNRYDYDEVEVLGHSGYAALRELLLAGDET
FT                   HMFLTYHLIYPPGTRIITVSLKPPLPLLYKEMAPLAVSVCA"
FT                   /protein_id="YP_003165360.1"
FT   gene            65845..66924
FT                   /db_xref="GeneID:8402183"
FT                   /locus_tag="CAP2UW1_0058"
FT   CDS_pept        65845..66924
FT                   /locus_tag="CAP2UW1_0058"
FT                   /gene_family="HOG000253896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: dar:Daro_0032 uroporphyrinogen decarboxylase
FT                   HemE; TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="GI:257091720"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="GeneID:8402183"
FT                   /translation="MTRPSNDSFLRALLKEPTAYTPVWLMRQAGRYLPEYCETRKRAGS
FT                   FLQLCKNPALACEVTLQPLARYDLDAAILFSDILTIPDAMGLGLYFTDGEGPRFERPLR
FT                   EEWAIRDLTAPDPWDHLRYVMDAVAEIRRALHNSVPLIGFAGSPYTLACYMVEGASSSD
FT                   YRCIKGMLYERPDLLHRILSVTADAVTAYLNAQIESGAQAVMIFDSWGGSLSAAAYEEF
FT                   SLQYMQRIVGNLLRERGGERVPSIVFTKGGGLWLEAIADIGCDAVGLDWTIDIGEARRR
FT                   VGDRVALQGNIDPAVLFASPEKVAAEARRVLESYGAGQNTGHVFNLGHGISQFTPPENV
FT                   TALVEEVHAHSVLLRTRSE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165361.1"
FT   misc_feature    65872..66891
FT                   /note="Uroporphyrinogen decarboxylase (URO-D) is a dimeric
FT                   cytosolic enzyme that decarboxylates the four acetate side
FT                   chains of uroporphyrinogen III (uro-III) to create
FT                   coproporphyrinogen III, without requiring any prosthetic
FT                   groups or cofactors. This...; Region: URO-D; cd00717"
FT                   /db_xref="CDD:48141"
FT                   /locus_tag="CAP2UW1_0058"
FT   misc_feature    order(65920..65937,65950..65952,65962..65964,65980..65982,
FT                   66061..66081,66115..66117,66130..66132,66274..66276,
FT                   66304..66306,66322..66324,66463..66465,66469..66474,
FT                   66586..66588,66829..66831)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48141"
FT                   /locus_tag="CAP2UW1_0058"
FT   misc_feature    order(65923..65925,65935..65937,66073..66075,66304..66306,
FT                   66469..66471,66829..66831)
FT                   /note="active site"
FT                   /db_xref="CDD:48141"
FT                   /locus_tag="CAP2UW1_0058"
FT   gene            67267..69291
FT                   /db_xref="GeneID:8402184"
FT                   /locus_tag="CAP2UW1_0059"
FT   CDS_pept        67267..69291
FT                   /locus_tag="CAP2UW1_0059"
FT                   /gene_family="HOG000037413" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="primosomal protein N'"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_0033 replication restart DNA helicase
FT                   PriA; TIGRFAM: primosomal protein N'; PFAM: helicase domain
FT                   protein; type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases"
FT                   /db_xref="GI:257091721"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:8402184"
FT                   /translation="MPQIVRVALDVPLRRFFDYCVPKGECLSVDDIGCRVRVPFGQQRK
FT                   IGIIVGLPSESAVPLAQLRSCEVVLRDLPPLPADWFRLVEFCAAYYQAPVGQVMLSTLP
FT                   AGLRSTTPAKPRPVRRLPDDTRAIAAPALTAEQEMSLAAIAAGGPGFHAYLLHGVTGSG
FT                   KTEIYLRLIERTLAAGRQSLLLVPEINLTPQLEARVMARFPAAGLVSLHSELGESARNR
FT                   NWRAALSGAARIVLGTRLAVFAPLPEPGLIVVDEEHDASFKQQDGIRYSARDLAVFRAR
FT                   QCGIPIVLGSATPSLESWANAAGNGAGNGARARYRLLSLHARAVEGARLPVVRRVDTRV
FT                   DKPIDGLSGALLEAIEKRLERGEQSLLFLNRRGYAPVLACMACGWTSGCRRCAAHLVLH
FT                   LADRCLRCHHCGYAAAVPKACPTCGNQDLSAFGRGTQRLEVVLGERFPQARVLRVDRDS
FT                   ASSRTHWEALVARIHAGEVDILVGTQMLAKGHDFPKLTLVGVVSPDAALFAADWRAPER
FT                   LFAQLMQVAGRAGRADRPGEVLIQTQFPDHPLYAALVDHDYPAFAAAHLKERQQAGFPP
FT                   YTHQAMLRAEAPRMADALSFLNTARACPPPGCENAVTFYDAVPMRLSRRASRERGQLLV
FT                   ESSSRRVLQQFLAGWVVQIEAIKAPGSLRWHLEVDPLEF"
FT                   /protein_id="YP_003165362.1"
FT   misc_feature    67267..69288
FT                   /note="primosome assembly protein PriA; Validated; Region:
FT                   PRK05580"
FT                   /db_xref="CDD:180144"
FT                   /locus_tag="CAP2UW1_0059"
FT   misc_feature    67729..68148
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="CAP2UW1_0059"
FT   misc_feature    67747..67761
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="CAP2UW1_0059"
FT   misc_feature    68029..68040
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="CAP2UW1_0059"
FT   misc_feature    <68662..68862
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="CAP2UW1_0059"
FT   gene            69634..71172
FT                   /db_xref="GeneID:8402185"
FT                   /locus_tag="CAP2UW1_0060"
FT   CDS_pept        69634..71172
FT                   /locus_tag="CAP2UW1_0060"
FT                   /gene_family="HOG000258672" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: abo:ABO_2461
FT                   hypothetical protein"
FT                   /db_xref="GI:257091722"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="GeneID:8402185"
FT                   /translation="MSSDFVAAIDLGSNSFHMIVARIANGRVQVLDRLREMVQLAAGLD
FT                   SRNRLSPQSQQRALDCLARFGQRLRHIPPTRVRIVGTNTLRQARNSAEFVARAEQVLGH
FT                   KVEIVAGQEEARLIYLGVAHSVGDVPGQRLVVDIGGGSTELIIGEQFDPLHLASLRMGC
FT                   VSISRHCFGNGRVTAGRLREAELLVQLNLEPVREEYLARGWEVVTGASGSIKAIQDVVV
FT                   SEGWCREGISLDALRRLRTALLEVRDTAEIASRWQLDPARARVFFGGFVILHGLCETLG
FT                   VQQLEVSEGALREGLIYDLLGRIRHEDVRDRTIADVIGRFGLDEAQAGRVSGTALELHR
FT                   QVRAKWQLTGKEARHVLERAARLHEIGLLLTHDQYHRHGAYVLEHSDLPGYSRDDQRLL
FT                   SALVGRHRRSFPADAFSHLPKDWARPARRLCVLLRLAVVLHRGRSSEPLPAISLRVDRQ
FT                   RLVLRLPAGWLDQHPLTRADLEIEARQLRKAGFDLEIGRSGPVTLPPAPAAGLP"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165363.1"
FT   misc_feature    69637..71118
FT                   /note="guanosine pentaphosphate phosphohydrolase;
FT                   Provisional; Region: PRK11031"
FT                   /db_xref="CDD:182914"
FT                   /locus_tag="CAP2UW1_0060"
FT   misc_feature    69649..70539
FT                   /note="exopolyphosphatase; Region: exo_poly_only;
FT                   TIGR03706"
FT                   /db_xref="CDD:163418"
FT                   /locus_tag="CAP2UW1_0060"
FT   gene            71275..72513
FT                   /db_xref="GeneID:8402186"
FT                   /locus_tag="CAP2UW1_0061"
FT   CDS_pept        71275..72513
FT                   /locus_tag="CAP2UW1_0061"
FT                   /gene_family="HOG000118528" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_2845 hypothetical protein"
FT                   /db_xref="GI:257091723"
FT                   /db_xref="GeneID:8402186"
FT                   /translation="MRFLAWLAASLLLSLLVVFFLLVAALEPAPLVTRGETISPASIAQ
FT                   AKLLLARNDPRRLARGDERTADLPAALIDDGVNHLANRLLHGRGAFVMGEDSAQIRLSV
FT                   RVPGLPGPRFLNLGAVFKEAEGEPHVASATLGSLPVPAALIELLMASAIKLAGFGDDWQ
FT                   LARQSIRRLMFEPGRGVVVITYVWEPEILDRALALAFTPEDLLHLEAAQRALAGLLDHH
FT                   GPRARVPLPEILGTLLAHTGDGSLVQRRAALLVLATHQSGQSLVRLLPQARQWPRPRPV
FT                   KLILLGRGDSAQHFAISAALAAWAGEPAANAIGVYKEVEDARHGSGFSFADLAADRAGT
FT                   RFGQLVADASPRLNAALGRTLTDADLAPALGGLPEYLSESEFQRRFGGSGNAAYAQVMA
FT                   EIERRLAALPLYR"
FT                   /protein_id="YP_003165364.1"
FT   sig_peptide     71275..71352
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.645 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_0061"
FT   misc_feature    72085..72312
FT                   /note="Predicted periplasmic lipoprotein (DUF2279); Region:
FT                   DUF2279; cl11574"
FT                   /db_xref="CDD:187094"
FT                   /locus_tag="CAP2UW1_0061"
FT   gene            complement(72557..73756)
FT                   /db_xref="GeneID:8402187"
FT                   /locus_tag="CAP2UW1_0062"
FT   CDS_pept        complement(72557..73756)
FT                   /locus_tag="CAP2UW1_0062"
FT                   /gene_family="HOG000258650" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dar:Daro_0035 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:257091724"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:8402187"
FT                   /translation="MLWLKLFLPFAGAYFLSYLYRTANAVIGPILTAELALGAGSLGLL
FT                   TSAYFLSFAAAQLPLGMLLDRFGARRVESGLLLIAATGAATFAIGKSIGDLAFSRALIG
FT                   LGVSACLMAAFKAFSLWFPADRQASLTGWIMTSGGLGALAATAPLEAALQVAGWREIFV
FT                   GLAGLTLLVAIWLFLSVPERTDGAKPEPLAAQWAGVRQVFASAHFWRFAPLGLTLVGGF
FT                   MAVQSLWSVSWLMQVNGYARAVAADHMAGMSAAMLIAYLLIGLLATGLARRGIKPLMLL
FT                   AAGLGLSLLTLALIVTQAVEHTHLLWIAYGSFSSFGTLAYSQAAAGFAVALSGRANTAF
FT                   NLMVFVGAFGVQWGLGLLIDLLQAQGQTAAMAHRNALLSLLGAQLAAYLWFLLAGRRVR
FT                   "
FT                   /protein_id="YP_003165365.1"
FT   sig_peptide     complement(73679..73756)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.617 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_0062"
FT   misc_feature    complement(72710..73612)
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="CAP2UW1_0062"
FT   gene            complement(73781..74719)
FT                   /db_xref="GeneID:8402188"
FT                   /locus_tag="CAP2UW1_0063"
FT   CDS_pept        complement(73781..74719)
FT                   /locus_tag="CAP2UW1_0063"
FT                   /gene_family="HOG000150087" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ROK family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ROK family protein; KEGG: dar:Daro_0037
FT                   N-acetylglucosamine kinase"
FT                   /db_xref="GI:257091725"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="GeneID:8402188"
FT                   /translation="MATQRTRTRLFRRLRIGIDLGGTKIELVALDESGNVLRRRRRPTP
FT                   QGDYLATIRVVTELVAAAEDDLGGRGSVGIGIPGTESVAAGHIKNANSTCLIGRPLRDD
FT                   LQRLLQREVRLANDANCFALSEAIDGAGRGAEVVFGVILGTGVGGGIVVNQRVLTGVNR
FT                   IAGEWGHNPLPSAEEEGLPPPACYCGRSGCVETWLSGPALSLDHWRHHGESLTAEAVGA
FT                   RAGAGDLAANASLQRYERRLAKALAQVINILDPDVIVLGGGLSNLERLYRSVPMLWTAH
FT                   VFSDEVRTRLLPNVHGDSSGVRGAAWLWDEA"
FT                   /protein_id="YP_003165366.1"
FT   misc_feature    complement(73793..74674)
FT                   /note="fructokinase; Reviewed; Region: PRK09557"
FT                   /db_xref="CDD:181951"
FT                   /locus_tag="CAP2UW1_0063"
FT   misc_feature    complement(73796..74671)
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:186831"
FT                   /locus_tag="CAP2UW1_0063"
FT   gene            74953..75201
FT                   /db_xref="GeneID:8402189"
FT                   /locus_tag="CAP2UW1_0064"
FT                   /pseudo
FT   gene            75257..76315
FT                   /db_xref="GeneID:8402190"
FT                   /locus_tag="CAP2UW1_0065"
FT   CDS_pept        75257..76315
FT                   /locus_tag="CAP2UW1_0065"
FT                   /gene_family="HOG000227445" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; homoserine dehydrogenase NAD-binding; KEGG:
FT                   cvi:CV_4127 probable dehydrogenase"
FT                   /db_xref="GI:257091726"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="GeneID:8402190"
FT                   /translation="MRNYPTITGRKIRLALVGCGRIAANHFAAMEQHAEDVEIVDVCDV
FT                   DRNALDKAVQRTLAHGHLSMTEMLKASTADLVVLTTPSGLHPEQTIEIAESGRHVMTEK
FT                   PMATRWHDGLHMVKACDEAGVRMFVVKQNRRNATLQLLKRAVEQKRFGRIYMVNINVFW
FT                   TRPQEYYDSAKWRGTWEFDGGAFMNQASHYVDLLDWLIGPIESIQAYTATLGRDIQVED
FT                   SGVLSVRWRSGALGSMNVTMLTYPKNLEGSITILGEKGTVRVGGVAVNEIQHWDFAEKM
FT                   PEDDKISAANYETTSIYGFGHPLYYDNVIKVMRGEAEPETDGREGLKSLETLIAAYLAA
FT                   RDGKRVALPLDY"
FT                   /protein_id="YP_003165367.1"
FT   misc_feature    75281..76306
FT                   /note="Predicted dehydrogenases and related proteins
FT                   [General function prediction only]; Region: MviM; COG0673"
FT                   /db_xref="CDD:31017"
FT                   /locus_tag="CAP2UW1_0065"
FT   misc_feature    75290..75643
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0065"
FT   misc_feature    75683..76030
FT                   /note="Oxidoreductase family, C-terminal alpha/beta domain;
FT                   Region: GFO_IDH_MocA_C; cl11611"
FT                   /db_xref="CDD:159579"
FT                   /locus_tag="CAP2UW1_0065"
FT   gene            76318..76893
FT                   /db_xref="GeneID:8402191"
FT                   /locus_tag="CAP2UW1_0066"
FT   CDS_pept        76318..76893
FT                   /locus_tag="CAP2UW1_0066"
FT                   /gene_family="HOG000049436" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: aav:Aave_0951 transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="GI:257091727"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="GeneID:8402191"
FT                   /translation="MVLSIHPSAIVDEGAQIGDGSRVWHFAHICAGARIGTDCSFGQNV
FT                   FVGNDVAIGNNVKVQNNVSIYDAVQIEDDVFCGPSMVFTNVYNPRSAVTRKDEYRPTTI
FT                   KRGATLGANSTIVCGVTVGRFAFVAAGAVVTRDVKPYALMAGVPARQIGWISKHGERLR
FT                   LPLEGDGVAQCPVTGETYKLTGTTLAVE"
FT                   /protein_id="YP_003165368.1"
FT   misc_feature    <76327..>76512
FT                   /note="UDP-3-O-[3-hydroxymyristoyl]; Region: LpxD; COG1044"
FT                   /db_xref="CDD:31246"
FT                   /locus_tag="CAP2UW1_0066"
FT   misc_feature    76420..76776
FT                   /note="WcxM-like, Left-handed parallel beta-Helix (LbH)
FT                   N-terminal domain: This group is composed of Xanthomonas
FT                   campestris WcxM and proteins with similarity to the WcxM
FT                   N-terminal domain. WcxM is thought to be bifunctional,
FT                   catalyzing both the isomerization...; Region:
FT                   LbH_WxcM_N_like; cd03358"
FT                   /db_xref="CDD:100048"
FT                   /locus_tag="CAP2UW1_0066"
FT   misc_feature    order(76483..76485,76489..76491,76513..76515,76537..76539,
FT                   76543..76545,76561..76563,76579..76587,76636..76638,
FT                   76642..76644,76651..76653,76708..76710,76756..76758)
FT                   /note="putative trimer interface; other site"
FT                   /db_xref="CDD:100048"
FT                   /locus_tag="CAP2UW1_0066"
FT   misc_feature    order(76489..76491,76495..76497,76579..76581,76585..76587,
FT                   76642..76644,76648..76653,76666..76668,76702..76707,
FT                   76720..76725,76750..76755,76759..76761)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:100048"
FT                   /locus_tag="CAP2UW1_0066"
FT   misc_feature    order(76489..76491,76495..76497,76579..76581)
FT                   /note="putative substrate binding site; other site"
FT                   /db_xref="CDD:100048"
FT                   /locus_tag="CAP2UW1_0066"
FT   misc_feature    order(76579..76581,76585..76587,76642..76644,76648..76653,
FT                   76666..76668,76696..76698,76702..76707,76720..76725,
FT                   76744..76746,76750..76755,76759..76761,76771..76773)
FT                   /note="putative CoA binding site; other site"
FT                   /db_xref="CDD:100048"
FT                   /locus_tag="CAP2UW1_0066"
FT   gene            76890..77960
FT                   /db_xref="GeneID:8402192"
FT                   /locus_tag="CAP2UW1_0067"
FT   CDS_pept        76890..77960
FT                   /locus_tag="CAP2UW1_0067"
FT                   /gene_family="HOG000004811" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   aba:Acid345_3314 FAD dependent oxidoreductase"
FT                   /db_xref="GI:257091728"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:8402192"
FT                   /translation="MKVAVIGGGINGVMTAWAFARRGDSVDLFEKGRLMSATSHSSSKM
FT                   LHGGLRYLEHGHLRLVREALQERSWWIRQAPEFARPLELLIPIYRNGERAKWLVGAGIR
FT                   LYDLLAIGSGFPRGRWYSADEVVERFPGLKRDELLGAYGYWDARMDDYRLGLWAAERAG
FT                   ESGARLHEFTAVLKVHPATGEVALDGSSARYDRIVNVAGPWAETLLARSGVASAYRLDL
FT                   IRGSHIVVPGKLEHGCVLQVPGEKRILFVLPHGENTLLGTTEVSQADPDHCLPSDEEID
FT                   YLTTNYNRCFFEVVARQDIISSFAGIRPIVASKTDFSAASRESVIERQGRLINVFGGKW
FT                   TTSRALAEAVVTKSQY"
FT                   /protein_id="YP_003165369.1"
FT   misc_feature    76893..>77948
FT                   /note="Glycerol-3-phosphate dehydrogenase [Energy
FT                   production and conversion]; Region: GlpA; COG0578"
FT                   /db_xref="CDD:30923"
FT                   /locus_tag="CAP2UW1_0067"
FT   misc_feature    76893..>76988
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="CAP2UW1_0067"
FT   misc_feature    <77250..>77519
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="CAP2UW1_0067"
FT   gene            78315..79904
FT                   /db_xref="GeneID:8402193"
FT                   /locus_tag="CAP2UW1_0068"
FT   CDS_pept        78315..79904
FT                   /locus_tag="CAP2UW1_0068"
FT                   /gene_family="HOG000230164" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: glo:Glov_1506
FT                   DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="GI:257091729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="GeneID:8402193"
FT                   /translation="MDVNTHKQTDIQLVFDTNVLVDALTARGQYFACAVDLLEMVRNGK
FT                   VEGWYAHHTLTSVYYLLERAFAAETQNRKTATDLAQTLLRELLQFLRPLPQVGDELRRI
FT                   HSMPGDDLEDLLIVHLASSYLPNPLVVTRDKWFLQHSSLAAAHPKEIIERGLTAWQSRG
FT                   QPIPFADLTTQQHCIRPQLERNMHRVLHHGQYIMGPEVAELEGKLAAYTGAKHCITVAS
FT                   GTEALLIALMALGIKPGEEVITTPFTFVATAEVIVLLGAVPVFVDIEPDTCNIDASKIE
FT                   AAITSKTRAIIPVSLYGQPADMDEINAIAARHGLTVIEDAAQSFGAEYKGRKSCNLSTI
FT                   ACTSFFPSKPLGCYGDGGAIFSSDENLAKAMREIRVHGQEKRYVHTRIGVGGRMDTLQC
FT                   AVVLAKLERFDWEVEQRLKIGARYNALFAGKVQTVTQRPDRTSVFAQYTAFIENREQVQ
FT                   ERLKAAGVPTAVHYPVPLHLQPAYRGGCQVHGGVKTAERMAQRVMSFPMSADLSVEDQE
FT                   RVVAAALEVVRN"
FT                   /protein_id="YP_003165370.1"
FT   misc_feature    78810..79862
FT                   /note="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis
FT                   [Cell envelope biogenesis, outer membrane]; Region: WecE;
FT                   COG0399"
FT                   /db_xref="CDD:30748"
FT                   /locus_tag="CAP2UW1_0068"
FT   misc_feature    78876..79862
FT                   /note="3-amino-5-hydroxybenzoic acid synthase family
FT                   (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate
FT                   (PLP)-dependent aspartate aminotransferase superfamily
FT                   (fold I). The members of this CD are involved in various
FT                   biosynthetic pathways for secondary...; Region: AHBA_syn;
FT                   cd00616"
FT                   /db_xref="CDD:99740"
FT                   /locus_tag="CAP2UW1_0068"
FT   misc_feature    order(78981..78986,79272..79274,79281..79283,79344..79346,
FT                   79356..79361,79725..79727)
FT                   /note="inhibitor-cofactor binding pocket; inhibition site"
FT                   /db_xref="CDD:99740"
FT                   /locus_tag="CAP2UW1_0068"
FT   misc_feature    order(78981..78986,79056..79058,79272..79274,79281..79283,
FT                   79344..79346,79359..79361)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99740"
FT                   /locus_tag="CAP2UW1_0068"
FT   misc_feature    79359..79361
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99740"
FT                   /locus_tag="CAP2UW1_0068"
FT   gene            80182..81180
FT                   /db_xref="GeneID:8402194"
FT                   /locus_tag="CAP2UW1_0069"
FT   CDS_pept        80182..81180
FT                   /locus_tag="CAP2UW1_0069"
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bav:BAV0086 glycosyl transferase"
FT                   /db_xref="GI:257091730"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:8402194"
FT                   /translation="MYKNCSVAVVVPAYNEETQIAVVIESMPDIVDVIVIVNDCSKDQT
FT                   SQVVRRHSEFGSGRIVLLEHAENQGVGGAIATGYKWVRDNNYDVAVVMAGDGQMAPDDL
FT                   PAILDPVVDGEADYTKGNRLVTGEAFKKIPKIRFFGNSALSLLTKIASGYWHVADSQTG
FT                   YTAISQSALQAIDWDNMYKRYGQPNDLLVKLNVANMRVVDVPIEPVYNVGEKSGIKVRK
FT                   VIFTIGSLLVRLFFWRLKEKYIIRNFHPLVFFYAMGLGGLALSSILFVRMLSMWIGSGN
FT                   VPEITFLGSLFSFSLSVNSLFFAMWFDYDENKHLNPPLKHRETRRKSTQAE"
FT                   /protein_id="YP_003165371.1"
FT   misc_feature    80200..81012
FT                   /note="Glycosyltransferases involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane];
FT                   Region: WcaA; COG0463"
FT                   /db_xref="CDD:30811"
FT                   /locus_tag="CAP2UW1_0069"
FT   misc_feature    80206..80763
FT                   /note="DPM_DPG-synthase_like is a member of the
FT                   Glycosyltransferase 2 superfamily; Region:
FT                   DPM_DPG-synthase_like; cd04179"
FT                   /db_xref="CDD:133022"
FT                   /locus_tag="CAP2UW1_0069"
FT   misc_feature    order(80215..80217,80221..80223,80467..80469)
FT                   /note="Ligand binding site; other site"
FT                   /db_xref="CDD:133022"
FT                   /locus_tag="CAP2UW1_0069"
FT   misc_feature    80461..80469
FT                   /note="DXD motif; other site"
FT                   /db_xref="CDD:133022"
FT                   /locus_tag="CAP2UW1_0069"
FT   misc_feature    80464..80469
FT                   /note="Putative Catalytic site; other site"
FT                   /db_xref="CDD:133022"
FT                   /locus_tag="CAP2UW1_0069"
FT   gene            81177..82502
FT                   /db_xref="GeneID:8402195"
FT                   /locus_tag="CAP2UW1_0070"
FT   CDS_pept        81177..82502
FT                   /locus_tag="CAP2UW1_0070"
FT                   /gene_family="HOG000128174" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   bav:BAV0084 lipopolysaccharide biosynthesis protein"
FT                   /db_xref="GI:257091731"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="GeneID:8402195"
FT                   /translation="MIRPLIAQALHSLRHQKLSQDIAFSLGSFAVLAISGIVINIVITV
FT                   FRDAAALGVFNIAYAVYIVASQVAVWGLHYSVLRHAAYHASDQEARGHMLLTAAVCSIA
FT                   MGLGAGAVVFQAEPLFAVAFNSETTGAAIRNTALGLTVFPLNKVLIAYLNGLREMRAYA
FT                   VLQALRYLMIMALVALVAASSLPIEVSTFCFFVAELLTLVTACLYIASRRLVGTLGFRR
FT                   SWVVRHYQFGTKALAAGLFTEVNSRVDVLMIGIFLSDRATGIYSFAAMLVDGVYHVLAM
FT                   VRINFNPILVAAIRDRDWRTVLNLRRQARRIVLPVTIVLALGLIATYYVFTAWVMPSEK
FT                   GLLEGLPSLAILLGGLTLICFLVPFDNLLMVSGHPGYQTLQQLVLVVTNITVAVLLLPL
FT                   LGIEGAALGTAVSYVAGVLTMAIFANRLLGWNLFTNTIRSAE"
FT                   /protein_id="YP_003165372.1"
FT   misc_feature    81228..81992
FT                   /note="Polysaccharide biosynthesis protein; Region:
FT                   Polysacc_synt; cl10513"
FT                   /db_xref="CDD:187004"
FT                   /locus_tag="CAP2UW1_0070"
FT   misc_feature    81879..>82454
FT                   /note="Na+-driven multidrug efflux pump [Defense
FT                   mechanisms]; Region: NorM; COG0534"
FT                   /db_xref="CDD:30880"
FT                   /locus_tag="CAP2UW1_0070"
FT   gene            82499..84817
FT                   /db_xref="GeneID:8402196"
FT                   /locus_tag="CAP2UW1_0071"
FT   CDS_pept        82499..84817
FT                   /locus_tag="CAP2UW1_0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Spermidine synthase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ade:Adeh_1209 hypothetical protein"
FT                   /db_xref="GI:257091732"
FT                   /db_xref="GeneID:8402196"
FT                   /translation="MSNTRFISGLLGAAILLSGFAALCYQVTWQRALTQSIGADAIAVV
FT                   LVVTIFMTWLGVGAALARSLLRRSRRRIAFNYAVVEMVISMCGLVSVPVLRAANGAFAL
FT                   TGIDSVWADFALNLLVLAIPIIGMGMTTPLIVHAARQALDNFGRTVGYIYGLNILGAAA
FT                   GALISGLVLLEWLGLQGVTQLAAVLNMLAACAVLLALRKFPPDAADPAPEGQLPFGRID
FT                   LAAILFGFGTLAMQVLYFRILHAYLTLSTLVFPIVLSAYLLLMSLGQWLGGWLADRFQR
FT                   RLAAIAAALFAAGSLLMVAALNMPPNWAIPFGALRFTAFNGSLLLENRHLIGDPPVLGA
FT                   LSFSLLFMMSVAAWSALFPVLLKVATRHIDEAGASFGHLYGMYTVGNVAGTFLTGALIL
FT                   AWVGTTGAAACAIVVVGAGAWLLLGGRGEAEPEPALGRGLAAVGLLAALLVPANFYGKF
FT                   QLDNYSISDVFEGRVGVATVSPTTRFYHIVDMSRTASASAMVREPGPGDSYEAWRWNHS
FT                   ELMALDPSFRPRRVLVIGIGHAYLPHALLDLPSVQEIVVVDLSPEIVGAVKKHTATSAR
FT                   RVFSDPRVRIVIADGRRYAQSALKRGERFDLVQIKINEPWHAGSGNLFSVEFFRMIKGL
FT                   LAEGGYLGVRPLVGHLSDGMQVFDGALYPGYYHLFFKNGEIPLVEQAVVTPDIADAWRR
FT                   ELPGAAALGPSRNGALEIMQFDARSPRPQIDLNTDDRPTFEYYWLRQRLGTWISPRDGL
FT                   DNPRFNEYRRTVPVLTPLE"
FT                   /protein_id="YP_003165373.1"
FT   sig_peptide     82499..82579
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.439 at
FT                   residue 27"
FT                   /locus_tag="CAP2UW1_0071"
FT   misc_feature    83948..>84418
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:187159"
FT                   /locus_tag="CAP2UW1_0071"
FT   gene            84825..86879
FT                   /db_xref="GeneID:8402197"
FT                   /locus_tag="CAP2UW1_0072"
FT   CDS_pept        84825..86879
FT                   /locus_tag="CAP2UW1_0072"
FT                   /gene_family="HOG000128173" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamine amidotransferase class-II"
FT                   /transl_table="11"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   bav:BAV0087 lipopolysaccharide biosynthesis protein"
FT                   /db_xref="GI:257091733"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="GeneID:8402197"
FT                   /translation="MCGIFGIALRQGADMLPDTVRKLLTNLYVFSESRGKESAGLHLYL
FT                   PDAASAWTLKGAQAATELLRTKAYKEALSQGLTLAYGSSKDSLAQPLIVMAHSRLVTNG
FT                   TAALDRNNQPVRWGGVSMIHNGIVVNVDKLWQTNPDLKRAAEVDTEVMAAVIDRSLRQE
FT                   FDPIKATRTVFSAIKGAASVAWVHEEASTVTLATNTGDLYVATLPEEMGLVFASERYIL
FT                   TEALAKTLGREGAASIMSNLEWLQAGNGLVFDLNAAGSARHFGLAPDADLVAMACMRHL
FT                   AARQHDIGAASSNPAPVGFSNQVDEKLVRYGEERIRGLRRCTCCVLPETFPFIEFDEKG
FT                   VCNYCRSYKPRYAGMHPTETRKTFIDSLVKYRRNGKEPDVLVPFSGGRDSSYGLHLIHE
FT                   EFGLRPITFTYDWGMVTDLARRNVARMCGQLGIPNILVSADIKAKRENIRKNVAAWLKK
FT                   PDLGMVPLFMAGDKHFFRVVNQLKRQTGIALDLWCANPLENTDFKSGFCGVRPDFDKSR
FT                   VDYLSIGRKAQMAAYYGARFLRNTGYLNASLLDTFGAFVAYYFEPRRDFYFIFDHFIWN
FT                   EDEVNKTLLSTYDWELSPDSPSTWRIGDGTAPFYNYVYMTARGFSEFDTFRSNQIREGM
FT                   ITREMALESIAVENRPRMESLRWYLATIGLDFNETIRRVNELDTMGLHR"
FT                   /protein_id="YP_003165374.1"
FT   misc_feature    84828..85520
FT                   /note="Glutamine amidotransferases class-II (GATase). The
FT                   glutaminase domain catalyzes an amide nitrogen transfer
FT                   from glutamine to the appropriate substrate. In this
FT                   process, glutamine is hydrolyzed to glutamic acid and
FT                   ammonia. This domain is related to...; Region: Gn_AT_II;
FT                   cd00352"
FT                   /db_xref="CDD:48475"
FT                   /locus_tag="CAP2UW1_0072"
FT   misc_feature    order(84828..84830,85119..85121,85197..85205,85266..85268)
FT                   /note="active site"
FT                   /db_xref="CDD:48475"
FT                   /locus_tag="CAP2UW1_0072"
FT   misc_feature    85959..86360
FT                   /note="Adenine nucleotide alpha hydrolases superfamily
FT                   including N type ATP PPases, ATP sulphurylases Universal
FT                   Stress Response protein and electron transfer flavoprotein
FT                   (ETF). The domain forms a apha/beta/apha fold which  binds
FT                   to Adenosine nucleotide; Region: AANH_like; cl00292"
FT                   /db_xref="CDD:185887"
FT                   /locus_tag="CAP2UW1_0072"
FT   misc_feature    order(85971..85976,85983..85994,86049..86051,86055..86057)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:73291"
FT                   /locus_tag="CAP2UW1_0072"
FT   gene            86876..88057
FT                   /db_xref="GeneID:8402198"
FT                   /locus_tag="CAP2UW1_0073"
FT   CDS_pept        86876..88057
FT                   /locus_tag="CAP2UW1_0073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091734"
FT                   /db_xref="GeneID:8402198"
FT                   /translation="MRPAHARWAAKSLLLGMVVASLAACSKVDEAALLKAELPLMWVRM
FT                   AGPSPGKGLVDYPSDGPADIPKAYAMILLAAVDAQRAGRGFPEAGTVSGLWLLDHADEN
FT                   RNGITGWGVPVAWDAYGDGSENPASTEYTIATAIAVHALLDWAGEPGTAPRDRIMEVVL
FT                   AASQPYFDASMRTPAGLLPYSLSPPDRRYDTFNPAAYMAGQMQRLSRLVNDPGQAELLR
FT                   QAADQTMQALLDHRKVNPATGSWYWNYSVQEDSSNDLPHASYVVDGIRTYIRHGGRLAA
FT                   AFDREKVLAHLDEFLGEKTPDIRAWPRLRPDVTLAARSYDIGMALHVACTEPAMAGLRT
FT                   RLIAATPAYKDPDGQYLKYPAASKERNFVVREYETYLLRGFETCLAHPVGGAK"
FT                   /protein_id="YP_003165375.1"
FT   sig_peptide     86876..86956
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.584 at
FT                   residue 27"
FT                   /locus_tag="CAP2UW1_0073"
FT   gene            88054..91224
FT                   /db_xref="GeneID:8402199"
FT                   /locus_tag="CAP2UW1_0074"
FT   CDS_pept        88054..91224
FT                   /locus_tag="CAP2UW1_0074"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pth:PTH_1110 hypothetical protein"
FT                   /db_xref="GI:257091735"
FT                   /db_xref="GeneID:8402199"
FT                   /translation="MSWRMFAVPAAMVVSLLLASCGGQAENPQARAPVAPPEDIKLEAS
FT                   TPLSAYRKPLVEDAVVTPRIRGAVEVPFVVLRAGKAAATVELDIAANQSTLRMDNGQRI
FT                   PLARPGVPVVLLDLGEARTGAIVRSLPDSELWLADWTNAAKGMRFTKVKRPGVEFLMFR
FT                   AALFHEGVLNLVLYDNHAAKNYLRRLRLEGNQWVAAGPELELPTMEDPAGTHYEMEPPV
FT                   FLFGEKDGLRILAGTLNAKAGAEWIEVKRIEDCAKVLEAIATPTGVGILCNRKNVDTLG
FT                   AYTVVHPAGEPPEVLPLSQGIPWKLSWDEAAARLAWRKATDTQSYGEMMEHDIQRGQNG
FT                   GMLELGSNNIEGRIAWSQIYYLNGFMDAVHLARREQQAFDVFYPLLEKLRLRIELEVRL
FT                   IDRQLGAPEGLRTRAFTKDRSLALFGVQTSRALLLLTRYLEEFPGAPPLANLGKFEREV
FT                   KALQGHIEVMANAGEAEKWLAPGTRHLRWPKGSAFYYDGMPVPYNHQNEWAYGVLDAHR
FT                   AAGGKTDDPAVEAQREIIRHFISRLGKDGRFPEPLAWDYWWGHAYDGYDEASARSLNTP
FT                   SYVGDKSAAWISFRTIDLMSVLGARGYVAEAGGEGFAVSARDLIMRGEVYPFAARSLDM
FT                   DGARAGYHSTVAHKYARSGAPWEIANVPWALATLPAGKEAEDPHSYRLNEKVVGRLPSI
FT                   ASAGADRRQADQLLLDYLAIALPYNASMATREAGRELGGKYVAWNLAYDMRAAVLAYER
FT                   TKDGRFLALFERAADRLIAMRDDRLGVVDDLRGRPAKSWGSNRYSANKQKWVAWDAFAG
FT                   MAVYPLVKYCVVARGMPSAARLCAQYRKVAEEALAEYGPYWRDDEASGGGFYVDPYLED
FT                   IAPLNHMLTLGLVHIELQKLGASGHKDRAIKLARFFRHHWKDRNNGSVEWEYWAGAQQA
FT                   KHKSATAEDVTHAQINVHFAYESYKVGNVITKDDMAKLAKTLLLNVRKNQGDWAADLAG
FT                   GGQIIGSGLHEGLTGWVILDEFDGGVARLIARFVMEHPAAFPLGNFSYATGPIAMAYGL
FT                   PGLLKRAP"
FT                   /protein_id="YP_003165376.1"
FT   sig_peptide     88054..88131
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_0074"
FT   gene            complement(91329..91778)
FT                   /db_xref="GeneID:8402200"
FT                   /locus_tag="CAP2UW1_0075"
FT                   /pseudo
FT   gene            complement(91775..92359)
FT                   /db_xref="GeneID:8402201"
FT                   /locus_tag="CAP2UW1_0076"
FT                   /pseudo
FT   gene            complement(92375..93289)
FT                   /db_xref="GeneID:8402202"
FT                   /locus_tag="CAP2UW1_0077"
FT                   /pseudo
FT   gene            complement(93366..93563)
FT                   /db_xref="GeneID:8402203"
FT                   /locus_tag="CAP2UW1_0078"
FT   CDS_pept        complement(93366..93563)
FT                   /locus_tag="CAP2UW1_0078"
FT                   /gene_family="HOG000158227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cti:RALTA_p0541 hypothetical protein"
FT                   /db_xref="GI:257091736"
FT                   /db_xref="GeneID:8402203"
FT                   /translation="MKRRRLSLFPDGLSDESAAAISEFLHQLAAACEARYLVQLRRHRS
FT                   RQMNLYDPEAPWRIPPGEPF"
FT                   /protein_id="YP_003165377.1"
FT   gene            complement(93560..94354)
FT                   /db_xref="GeneID:8402204"
FT                   /locus_tag="CAP2UW1_0079"
FT   CDS_pept        complement(93560..94354)
FT                   /locus_tag="CAP2UW1_0079"
FT                   /gene_family="HOG000158228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AAA ATPase"
FT                   /transl_table="11"
FT                   /note="SMART: AAA ATPase; KEGG: gka:GK1917 hypothetical
FT                   protein"
FT                   /db_xref="GI:257091737"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:8402204"
FT                   /translation="MYLQHFGLRHPPLGKDAAELWDDGALAQLAERFQWLLQSPGLGLL
FT                   TGEAGVGKTAALRLVTAKLNPHRYQVIYHAETDFGRADLYRCLAQSLGLQPSYRRAQLW
FT                   RDIKAHIHHLADAKQLLPVWILDEAQNLPPEFFRDFPAFLNFAFDSRDLITVWLVGHPI
FT                   LAQTLERASYAALAGRIQARVHLRPVLERERFAQLVGHALKSAGCAHALLTDSGLELLR
FT                   QASKGLPRHAGRILRTAMRLAVPRALNHLPDDLLQAALEELR"
FT                   /protein_id="YP_003165378.1"
FT   misc_feature    complement(93626..94354)
FT                   /note="Type II secretory pathway, component ExeA (predicted
FT                   ATPase) [Intracellular trafficking and secretion]; Region:
FT                   ExeA; COG3267"
FT                   /db_xref="CDD:33078"
FT                   /locus_tag="CAP2UW1_0079"
FT   misc_feature    complement(93665..94354)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="CAP2UW1_0079"
FT   gene            complement(94357..99037)
FT                   /db_xref="GeneID:8402205"
FT                   /locus_tag="CAP2UW1_0080"
FT                   /pseudo
FT   gene            94953..95249
FT                   /db_xref="GeneID:8402206"
FT                   /locus_tag="CAP2UW1_0081"
FT                   /pseudo
FT   gene            95416..95883
FT                   /db_xref="GeneID:8402207"
FT                   /locus_tag="CAP2UW1_0082"
FT   CDS_pept        95416..95883
FT                   /locus_tag="CAP2UW1_0082"
FT                   /gene_family="HOG000026445" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nha:Nham_2789 hypothetical protein"
FT                   /db_xref="GI:257091738"
FT                   /db_xref="GeneID:8402207"
FT                   /translation="MAPPSKPDSKPLSLAESGTVNPHAQDVQDAAFIDSDFFDPRDLVQ
FT                   VRYEMLRRVRTEGQTIVDIATRFGVSRPTFYKAQADFEREGLAGLLPVKRGPHGPHKIT
FT                   DEVMAFIEAARAQEEGLDAQGLVERIAQHFGLAVHRRTVERALARSKKKRR"
FT                   /protein_id="YP_003165379.1"
FT   misc_feature    95533..95646
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:186341"
FT                   /locus_tag="CAP2UW1_0082"
FT   misc_feature    95560..95880
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3415"
FT                   /db_xref="CDD:33221"
FT                   /locus_tag="CAP2UW1_0082"
FT   gene            95880..96164
FT                   /db_xref="GeneID:8402208"
FT                   /locus_tag="CAP2UW1_0083"
FT   CDS_pept        95880..96164
FT                   /locus_tag="CAP2UW1_0083"
FT                   /gene_family="HOG000158241" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091739"
FT                   /db_xref="GeneID:8402208"
FT                   /translation="MKPTGMTDGQTLTEGYESLRQESAEWPGGCHRSPGRALFLFKGMA
FT                   AWMRCVGETAPSPAAAALRKESRLPAGIEQNLINLVASMALATARERTP"
FT                   /protein_id="YP_003165380.1"
FT   gene            96161..98239
FT                   /db_xref="GeneID:8402209"
FT                   /locus_tag="CAP2UW1_0084"
FT   CDS_pept        96161..98239
FT                   /locus_tag="CAP2UW1_0084"
FT                   /gene_family="HOG000228685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MerR; Resolvase domain;
FT                   Recombinase; KEGG: bpt:Bpet1409 transposase"
FT                   /db_xref="GI:257091740"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="GeneID:8402209"
FT                   /translation="MMGEHHAKIQARHLKRNAYLYVRQSTLRQVLENTESTKRQYDLRE
FT                   RAMALGWRLDQVVVIDSDLGQSGASAVDREGFQRLVSEVGLGRAGIVMGLEVSRLARNS
FT                   TDWHRLLEICALADTLILDEDGVYDPAHFNDRLLLGLKGTMSEAELHVLRARLRGGILN
FT                   KARRGELEIRLPIGFDYDPAGRVRLDPDVRVQESVRQFFRTFRRTGSATATVKAFRAEG
FT                   LSFPHRIHRGPQTGELLWTDLEHSRALWLLHHPRYTGAFCFGRTRVRKQPDGSHRHQRL
FT                   PSEEWIALIRDAHAGYITWDEYEQNLQILRDNAQAPAAGRDRGPPREGPALLQGLAICA
FT                   KCGDRMTVRYHVTGARRVPDYVCQRRGVEHAEPICQQIVGGELDAAIGRLLVEVVTPVT
FT                   LGVALAVQKELESRSEDSDRLRRQAVEWARYESDLARRRYMRCDPDNRLVADSLEAEWN
FT                   QALRAQTAAQEHYDKQRQRETGLDDQQRVSILALARDFPRLWNDPHTPDRERKRMARLL
FT                   IADVTLLKEVDIRAQVRFSGGATHTLHLPLPKPAWMLRQTPSTVVAEIDRLLEDHTDSE
FT                   IADWLNDQGLISGDGKPFHRPMVRRIRIDYALPSRHDRLRARGLLTPQELAERLNIATA
FT                   TLKNWRRAGLLKAHRYDDKGGYLFEPPGPGTPIKHQHQGKTAGRATTREESLPAHTA"
FT                   /protein_id="YP_003165381.1"
FT   misc_feature    96206..96907
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="CAP2UW1_0084"
FT   misc_feature    96218..96640
FT                   /note="Serine Recombinase family, catalytic domain; a DNA
FT                   binding domain may be present either N- or C-terminal to
FT                   the catalytic domain. These enzymes perform site-specific
FT                   recombination of DNA molecules by a concerted, four-strand
FT                   cleavage and rejoining...; Region: Ser_Recombinase;
FT                   cd00338"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="CAP2UW1_0084"
FT   misc_feature    order(96227..96229,96233..96235,96452..96457,96464..96466)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="CAP2UW1_0084"
FT   misc_feature    96233..96235
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58115"
FT                   /locus_tag="CAP2UW1_0084"
FT   misc_feature    96752..97099
FT                   /note="Recombinase; Region: Recombinase; pfam07508"
FT                   /db_xref="CDD:148873"
FT                   /locus_tag="CAP2UW1_0084"
FT   gene            complement(99167..99691)
FT                   /db_xref="GeneID:8402210"
FT                   /locus_tag="CAP2UW1_0085"
FT   CDS_pept        complement(99167..99691)
FT                   /locus_tag="CAP2UW1_0085"
FT                   /gene_family="HOG000158229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: drm:Dred_0563 hypothetical protein"
FT                   /db_xref="GI:257091741"
FT                   /db_xref="GeneID:8402210"
FT                   /translation="MQRIVAGITTLEQHVETTQKAAEVYRPKSCPHCGLGVVHQHGHYE
FT                   RKADRRAVPPRLNPIPILRYRCAGCRRTCSRLPECIAPRRWYDWSVQQQVLQQRLNGAA
FT                   EHPGGPPDRHTGARWWNWLQERGKDFVFHLRVRFAELGRAVDTHGFWHQVFNSLGLPRA
FT                   MFWLDQEMSVP"
FT                   /protein_id="YP_003165382.1"
FT   gene            99957..101045
FT                   /db_xref="GeneID:8402211"
FT                   /locus_tag="CAP2UW1_0086"
FT   CDS_pept        99957..101045
FT                   /locus_tag="CAP2UW1_0086"
FT                   /gene_family="HOG000010171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:p2A281
FT                   transposase"
FT                   /db_xref="GI:257091742"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:8402211"
FT                   /translation="MITKEVYVEIEVLRKHGFSLRKIAAEVGCAVNTVRSHLAQGKQPR
FT                   YQRQKKRATKLSTHETYLCERQAAAQPQWIPATVLFREIRALGYAGGVSQLRAFMRTIR
FT                   PQGAADPVVRFETAPGEQLQIDWVEFRKGADPLYAFCATLGYSRASYVEFVTDMKVSTL
FT                   IDCHQHAFEALGGVARRLLYDNMKTVVLERDVDGPGEHRYHAGFLDYAKHCGFVINLCR
FT                   PYRARTKGKVERFNGYLRRSFYVPLISRLKQAGLPLDAVTANAEVRRWLKEVANVRIHA
FT                   STQVQPAQRLQEEQAHLQGIPPPWRGDIAAARPLDAPPPVEGATVRPTVAERIALPTPE
FT                   QHPLAVYAQLLTQLQAAAEMQP"
FT                   /protein_id="YP_003165383.1"
FT   misc_feature    99957..100826
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="CAP2UW1_0086"
FT   misc_feature    100305..100679
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_0086"
FT   gene            101042..101827
FT                   /db_xref="GeneID:8402212"
FT                   /locus_tag="CAP2UW1_0087"
FT   CDS_pept        101042..101827
FT                   /locus_tag="CAP2UW1_0087"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:p2A369 transposase/IS protein"
FT                   /db_xref="GI:257091743"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:8402212"
FT                   /translation="MNLQYERMLALCDSLNLPFVAQNYVGAAQEAAAQESAYSDFLEAL
FT                   LKAEVAGRQVRKQSMLTRLAGFPAIKTLEEFDYAFAAGVKRSQIDELAGLAFVERNENV
FT                   VLVGPSGVGKTHLAIALGYRAAQAGIKTRFTTAADLLLTLSAAHAQNQLKAVMHRAIAA
FT                   YRLLIIDEIGYLPMSREQANLFFQVIAARYEKGSLIVTSNLSFGQWDATFAQDATLTAA
FT                   LLDRLLHHAQIVPIAGESYRLKRQRQTGMVQARKAIAGG"
FT                   /protein_id="YP_003165384.1"
FT   misc_feature    101042..101812
FT                   /note="transposase/IS protein; Provisional; Region:
FT                   PRK09183"
FT                   /db_xref="CDD:181681"
FT                   /locus_tag="CAP2UW1_0087"
FT   misc_feature    101303..101659
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0087"
FT   misc_feature    101363..101386
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0087"
FT   misc_feature    order(101366..101389,101549..101551,101648..101650)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0087"
FT   misc_feature    101537..101554
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0087"
FT   gene            102147..102467
FT                   /db_xref="GeneID:8402213"
FT                   /locus_tag="CAP2UW1_0088"
FT   CDS_pept        102147..102467
FT                   /locus_tag="CAP2UW1_0088"
FT                   /gene_family="HOG000262980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein, possibly
FT                   transposase fragment"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:ebD46 hypothetical protein, possibly
FT                   transposase fragment"
FT                   /db_xref="GI:257091744"
FT                   /db_xref="GeneID:8402213"
FT                   /translation="MDKAGEREAYWRRHVGAWRESGATQKAYCDEHGLRSHSLSYWHVR
FT                   LAEGSGARKGGGPLTLVPAVRVPDAGASLPSLLLHGPQGWRLEFATLPPVGWLMALWGE
FT                   HA"
FT                   /protein_id="YP_003165385.1"
FT   gene            102464..102817
FT                   /db_xref="GeneID:8402214"
FT                   /locus_tag="CAP2UW1_0089"
FT   CDS_pept        102464..102817
FT                   /locus_tag="CAP2UW1_0089"
FT                   /gene_family="HOG000222383" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IS66 Orf2 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: eba:ebB55
FT                   transposase, fragment"
FT                   /db_xref="GI:257091745"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="GeneID:8402214"
FT                   /translation="MSAPIGAAPERIWLAVEAVDMRLGIDGLSVRIQASLGRSPCDGTA
FT                   YAFTNRRRSRLKLLVWDGTGVWLSQRRLHRGYFTWPSASDPVFALTAAQWRWLTAGVDW
FT                   QRRDAPAPANWQV"
FT                   /protein_id="YP_003165386.1"
FT   misc_feature    102485..102781
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_0089"
FT   gene            complement(103348..104151)
FT                   /db_xref="GeneID:8402215"
FT                   /locus_tag="CAP2UW1_0090"
FT   CDS_pept        complement(103348..104151)
FT                   /locus_tag="CAP2UW1_0090"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:ebA3781 transposition helper
FT                   protein"
FT                   /db_xref="GI:257091746"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:8402215"
FT                   /translation="MNPMLPLEPLLKQLRLSGILDSLEARNRQAIEAKLAYTDFLALLV
FT                   EDEVARRDQRQFAQRLRKAQVVGDKTLERFDCSHSPSVNHALIAELATCRFVLEQAPVL
FT                   IAGPTGTGKSHLVQSLCHCALRAGHEVLFISHAKLLAQLHAARATDSFERKLRQLARVD
FT                   VLAIDDFGLRPMRSPQDEDFHDLIDARYERTTTLLTSNLHFDEWGAAFPNKLMGAATLD
FT                   RLRDRAYQIILDGETRRKPRPLPEVRSPVQATAGRDASKPPPAAR"
FT                   /protein_id="YP_003165387.1"
FT   misc_feature    complement(103432..104085)
FT                   /note="DNA replication protein [DNA replication,
FT                   recombination, and repair]; Region: DnaC; COG1484"
FT                   /db_xref="CDD:31673"
FT                   /locus_tag="CAP2UW1_0090"
FT   misc_feature    complement(103537..103851)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0090"
FT   misc_feature    complement(103810..103833)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0090"
FT   misc_feature    complement(order(103549..103551,103648..103650,
FT                   103807..103830))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0090"
FT   misc_feature    complement(103645..103662)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0090"
FT   gene            complement(104207..105733)
FT                   /db_xref="GeneID:8402216"
FT                   /locus_tag="CAP2UW1_0091"
FT   CDS_pept        complement(104207..105733)
FT                   /locus_tag="CAP2UW1_0091"
FT                   /gene_family="HOG000023904" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG: eba:ebA3777
FT                   transposase"
FT                   /db_xref="GI:257091747"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:8402216"
FT                   /translation="MYEIRQMIQRLRLGESNRAVARAQGVGRDTVARVRDIAAAQNWLE
FT                   ATSPLPDDATMARYYQTAGGGAVKNASHLSTVEPFRENVLEWHRQGIAVSSIRQALARR
FT                   YGYGGSVHAVYRFLRSEAAPAPVATVMLDFAVGEQAQVDFGSGPLITDRHSGEVFKTWF
FT                   FVMTLSWSRHQYAEVVRNQSVETWLACHRHAFEWFNGVPRKVRIDNPKCAITRACYYEP
FT                   TVQRAYAELALGYAFVIDPCPVADPAKKGRVESGVKYVKGNFMPLREFHSLAHANAQLE
FT                   AWIQGEAGNRLHGSTRERPLMRFNETEQALLQPLPAVAPTCPTWAKAKLHGNGHVQHAY
FT                   CHYSAPFRLIHQTLWLEITPDVVRLYHEHELVAIHPRLFKAGTRSTVADHLPPDAQAYF
FT                   MRDPQWCLTQATAVGPACRAVVESLFAKRVLDQLRAVQGLLRLADQFGRNRLDAACSRA
FT                   LNFGTPSYRTIKQILQTGLDQQPELIDAPTLEAPYLSGGHFRRQPSDLLH"
FT                   /protein_id="YP_003165388.1"
FT   misc_feature    complement(104825..105640)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="CAP2UW1_0091"
FT   misc_feature    complement(104951..105331)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_0091"
FT   gene            105978..107375
FT                   /db_xref="GeneID:8402217"
FT                   /locus_tag="CAP2UW1_0092"
FT   CDS_pept        105978..107375
FT                   /locus_tag="CAP2UW1_0092"
FT                   /gene_family="HOG000222395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: eba:ebA5523
FT                   transposase"
FT                   /db_xref="GI:257091748"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:8402217"
FT                   /translation="MKFGVKSESLAAGSRGLFDETLAADLAACEARLAEKRQAAEMGPP
FT                   LPPPEKPKRERAGRQPLPDQLPRVEHLHEPNTCTCGRCGQALVRIGEDVTEKLSIVPAE
FT                   FFVERHIYPKYACRPCETLTAAPAVASIIDGGLAAPALLAWVMVSKYADHLPLYRLERQ
FT                   AARAGVTLSRSTLADWVGRTGVALEPLWQRLAEVLRQGTVLHADETPVQQLDPGRGKTK
FT                   RAYLWAYRSNALAGDPSIVVFDYQPGRGGKYVAAFLRDWQGALMVDDFAGYDALFRGHV
FT                   IELACLTHARRKFFDLHQANGSPVAAEALDRFAALYAIEATAKGKTVEERARRRKETSQ
FT                   PLLDALHLWLLSTRTTVAHGSALAKAIDYSLRRWPAIARYVTNGFYPIDNNPVENAIRP
FT                   IAIGKKNWLFAGSEAAGQRAAAIQSLLETARLNGIEPMAWLIDTLEKLPSWPNSRIDEL
FT                   LPLKKRE"
FT                   /protein_id="YP_003165389.1"
FT   misc_feature    106257..106805
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_0092"
FT   gene            complement(107399..108052)
FT                   /db_xref="GeneID:8402218"
FT                   /locus_tag="CAP2UW1_0093"
FT                   /pseudo
FT   gene            complement(108090..108425)
FT                   /db_xref="GeneID:8402219"
FT                   /locus_tag="CAP2UW1_0094"
FT                   /pseudo
FT   gene            108884..111463
FT                   /db_xref="GeneID:8402220"
FT                   /locus_tag="CAP2UW1_0095"
FT   CDS_pept        108884..111463
FT                   /locus_tag="CAP2UW1_0095"
FT                   /gene_family="HOG000201946" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bav:BAV0082 lipopolysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="GI:257091749"
FT                   /db_xref="GeneID:8402220"
FT                   /translation="MACLLMLAMIILASLAGYSLSRLLPWSSEARRAGVCVAAGLALGP
FT                   FLLGAGGVLTLGILAGALPSTHLVAVVVGLLGVALLALWRGRGIPQKEDDCRRAPRQFG
FT                   ELLVSGLLTLWIVALLVNVIFLPLTANDSLEYATVARLLYETRDLVSYPAIQPELSTSG
FT                   FFGPWTHPPLYVSLSYLTQIIQGHADEPGFMRFVSPWFAVCSTLLIITLGSLLKRLFGL
FT                   ISALIFLSTPLLFSGADSASIDALPVLAIGLIVASVVCLEARPFVRGLFSGCAVALGLW
FT                   THSQAILFFPLALGAIALQNGLARWRTTTIESVALCASALLLGGWPYWRNVRIFGNPIS
FT                   DSPAVFALPSLDWTGYFSYARGLDNWAAVLQYGLLKGWFSFQSFGWAFWLMTLGVVLAI
FT                   KPLRHPTWRATLLCGGRQALDSGSQLLWVSLGLISIYLGGVFASTLIGIDLMIKNDRYS
FT                   LVILPCVSLLGGYGAHVLLCRGASSLADTETGSVKRDFLAGVGFFLGVALLVQFVVQGV
FT                   YYRWRYVPAAVQISEADTPAAEAIKRSKLDKPLSQRRLEYFPNMAAMFWTRGNLPENAL
FT                   LLSLRPADMYYAQRKMVSYLDERLLPVYRETSPPRAAQMLRDLGITHLHVPDYGLPVMY
FT                   NSVLDRIIDDPALSRLMYSASGTQVFQLASEGNAGRALLSFEFTDFTPATTDWTQYRQL
FT                   NLGGQRLASALGFLSKRLPKDGISSSEWHVPLFHRDFSTMVANGRGRPLAVARHDLLPS
FT                   IRGGEEYRVTFDLAGNAFVKLWLVQFDEKGRLLLSGEYSSGVDRIAEVVLNHPDETRRV
FT                   SRRFLALPDAAYVRFGVEHLGYSEIQVRRAVLEHLGRPDSAVGGKGR"
FT                   /protein_id="YP_003165390.1"
FT   sig_peptide     108884..108949
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.909 at
FT                   residue 22"
FT                   /locus_tag="CAP2UW1_0095"
FT   misc_feature    109214..>110119
FT                   /note="4-amino-4-deoxy-L-arabinose transferase and related
FT                   glycosyltransferases of PMT family [Cell envelope
FT                   biogenesis, outer membrane]; Region: ArnT; COG1807"
FT                   /db_xref="CDD:31992"
FT                   /locus_tag="CAP2UW1_0095"
FT   gene            111917..113871
FT                   /db_xref="GeneID:8402221"
FT                   /locus_tag="CAP2UW1_0096"
FT                   /pseudo
FT   gene            112554..113657
FT                   /db_xref="GeneID:8402222"
FT                   /locus_tag="CAP2UW1_0097"
FT   CDS_pept        112554..113657
FT                   /locus_tag="CAP2UW1_0097"
FT                   /gene_family="HOG000056408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cti:RALTA_p0602 putative transposase, IS4 family"
FT                   /db_xref="GI:257091750"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402222"
FT                   /translation="MQSELDAFFANLANRADLLREVSAQAFAKARKQVSATAFELLNDH
FT                   FLALVDTQFGFPLWRGLRVVAGDATVLRLTLFGKTRDGRPFVRHVVDAIGFALYLPGIE
FT                   MTLAATLYSPDVGERQMLFEHLDKLRSKDILVLDRGYPAYWLFAALLQRGRHFCMRADS
FT                   LNFSAIQAFRRSGLAEQIVRLPAPCKQDALDYEIAATPCEVRLIRQVFGHKVRVLVTSL
FT                   LDLDAYPAAEFGALYHSRWRIEEAFKRIKHRLALEHLSGMSWLAARQDFGAKILCDNIN
FT                   ALAVHAASESLDPNTRASYFINRGDTFSRIKRTLGRWLLQGRDALDNITSVFNELIKNL
FT                   VQIKPNRSYPRKFTQKPHLSHAYKSGV"
FT                   /protein_id="YP_003165391.1"
FT   misc_feature    112728..113393
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="CAP2UW1_0097"
FT   gene            complement(113917..114774)
FT                   /db_xref="GeneID:8402223"
FT                   /locus_tag="CAP2UW1_0098"
FT   CDS_pept        complement(113917..114774)
FT                   /locus_tag="CAP2UW1_0098"
FT                   /gene_family="HOG000095951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_2941 hypothetical protein"
FT                   /db_xref="GI:257091751"
FT                   /db_xref="GeneID:8402223"
FT                   /translation="MKPYCGRQFTLDELQTLRHLIEANPSASRAQLSRQVCALLDWFKP
FT                   NGELKDMTCRVAMLRMQADGLLTLPAAQRCAPRQPEYLATAATDPQSLLVRPVHELPPL
FT                   HLRQVSGSAHSRLWNEYIARYHYLGYTPMAGSQSRYFVFAGEHRVALLSFGASAWKLAA
FT                   RERFIGWQEDERQRNLPLVVNNARFLILPWIQSKGLASKILAIIHRQLPNDWLARYGYR
FT                   PVLLETFVETPRHRGTCYQAANWIKVGQTTGRGKKCPTSKPILPIKDIWLHPLHRNFRS
FT                   ILCR"
FT                   /protein_id="YP_003165392.1"
FT   gene            complement(114771..116271)
FT                   /db_xref="GeneID:8402224"
FT                   /locus_tag="CAP2UW1_0099"
FT                   /pseudo
FT   gene            116701..119960
FT                   /db_xref="GeneID:8402225"
FT                   /locus_tag="CAP2UW1_0100"
FT                   /pseudo
FT   gene            118321..119646
FT                   /db_xref="GeneID:8402226"
FT                   /locus_tag="CAP2UW1_0101"
FT   CDS_pept        118321..119646
FT                   /locus_tag="CAP2UW1_0101"
FT                   /gene_family="HOG000228794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3230 transposase"
FT                   /db_xref="GI:257091752"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402226"
FT                   /translation="MGWAGEELKEVDLGDRRLNKRAITLLDTLAAKPTLSIPSACSGWS
FT                   ETIAAYRFLDNDAVTWEGILRPHWSCSRTRIACHKVVLMLQDTTELDFNGQSIDGLGPL
FT                   SYEAQRGLYVHPTYAVSTDREPLGVLDAWMWAREPKDANGQRPGIKESTRWVEGYERVA
FT                   ELAAELPDTRLVYVADRESDMIELMARAGELETPADWLLRAQHDRALPDGQKLWQTVTS
FT                   GEELGGISFTLPARHGQKARVVRQQLWARVVDLPHGKNKTIRATCVVAKEIDPPAGSTP
FT                   VEWRLLTNRTAETLAEVAELIDWYRARWEIEILFHILKNGCRIESLQLRTIDGLQRAIA
FT                   LYLIVSWRIAMLMRFGRTCPDLPADLFFDQDEWHAAYLLNKKKPPADPPTLNQVLRLVA
FT                   MLGGFLARKGDGEPGVKTIWIGLQRVMDCVVGLQFMREAAPG"
FT                   /protein_id="YP_003165393.1"
FT   misc_feature    <119155..119349
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="CAP2UW1_0101"
FT   gene            complement(120376..121629)
FT                   /db_xref="GeneID:8402227"
FT                   /locus_tag="CAP2UW1_0102"
FT                   /pseudo
FT   gene            121819..123165
FT                   /db_xref="GeneID:8402228"
FT                   /locus_tag="CAP2UW1_0103"
FT   CDS_pept        121819..123165
FT                   /locus_tag="CAP2UW1_0103"
FT                   /gene_family="HOG000229725" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ajs:Ajs_3022 polysaccharide biosynthesis protein"
FT                   /db_xref="GI:257091753"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="GeneID:8402228"
FT                   /translation="MRSVLVLVGGTAFAHAITGLALPILTRLYTPADFSILAVFASLLS
FT                   IVAVAACLRFDIAIPMPGRDSEAFNLLALAIGCAVVVSVGAGALVLLAPSWLPEITGRL
FT                   DLQPYLWLLPFGILLASAYSALQNWFVREKEFSLIARSRVAQSAASAGMQIGMAGFGAG
FT                   PVGLMFGYLLNTGSACVILAFRLVRHERFRQNIEGLTCSSLKQAWLNFSRFPKYSTLEA
FT                   LANSAAIQLPVIMIAALAAGPEAGYLLLAMSVIQAPMALFGTAIGQVYLSHAPEAHREG
FT                   GLGSFTTDVFGRLVRAGVGPLLAVGIIAPVIFGALFGEGWERAGWLVTWMTPCFIMQFL
FT                   ATPISMALHVTGKQRAALLLQVFGVVLRVCAVWAAAQFPNGSISEAYAISGLLFYLFYI
FT                   WTILYCVKCHCGEILQKALGGIWVSLAWVGVAIVFVLVWTTIMPMQPDR"
FT                   /protein_id="YP_003165394.1"
FT   misc_feature    121819..123132
FT                   /note="Membrane protein involved in the export of O-antigen
FT                   and teichoic acid [General function prediction only];
FT                   Region: RfbX; COG2244"
FT                   /db_xref="CDD:32425"
FT                   /locus_tag="CAP2UW1_0103"
FT   sig_peptide     121819..121869
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.671 at
FT                   residue 17"
FT                   /locus_tag="CAP2UW1_0103"
FT   gene            complement(123548..124651)
FT                   /db_xref="GeneID:8402229"
FT                   /locus_tag="CAP2UW1_0104"
FT   CDS_pept        complement(123548..124651)
FT                   /locus_tag="CAP2UW1_0104"
FT                   /gene_family="HOG000056408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cti:RALTA_p0602 putative transposase, IS4 family"
FT                   /db_xref="GI:257091754"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402229"
FT                   /translation="MQSELDAFFANLANRADLLREVSAQAFAKARKQVSATAFELLNDH
FT                   FLALVDTQFGFPLWRGLRVVAGDATVLRLTLFGKTRDGRPFVRHVVDAIGFALYLPGIE
FT                   MTLAATLYSPDVGERQMLFEHLDKLRSKDILVLDRGYPAYWLFAALLQRGRHFCMRADS
FT                   LNFSAIQAFRRSGLAEQIVRLPAPCKQDALDYEIAATPCEVRLIRQVFGHKVRVLVTSL
FT                   LDLDAYPAAEFGALYHSRWRIEEAFKRIKHRLALEHLSGMSWLAARQDFGAKILCDNIN
FT                   ALAVHAASESLDPNTRASYFINRGDTFSRIKRTLGRWLLQGRDALDNITSVFNELIKNL
FT                   VQIKPNRSYPRKFTQKPHLSHAYKSGV"
FT                   /protein_id="YP_003165395.1"
FT   misc_feature    complement(123812..124477)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="CAP2UW1_0104"
FT   gene            124915..125892
FT                   /db_xref="GeneID:8402230"
FT                   /locus_tag="CAP2UW1_0105"
FT   CDS_pept        124915..125892
FT                   /locus_tag="CAP2UW1_0105"
FT                   /gene_family="HOG000228794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:ebA3230 transposase"
FT                   /db_xref="GI:257091755"
FT                   /db_xref="GeneID:8402230"
FT                   /translation="MLGWEHWGWAGEELKEVDLGDRRLNKRAITLLDTLAAKPTLSIPS
FT                   ACSGWSETIAAYRFLDNDAVTWEGILRPHWSCSRTRIACHKVVLMLQDTTELDFNGQSI
FT                   DGLGPLSYEAQRGLYVHPTYAVSTDREPLGVLDAWMWAREPKDANGQRPGIKESTRWIE
FT                   GYERVAELAAEVPDTRLVYVADRESDMIELMARAGELDTPADWLLRAQHDRALPNGEKL
FT                   WQTVTSGEELGGISFTLPARDGQKARVVRQQLWARVVDLPHGKNQTIRATCVVAKEIDP
FT                   PAGSTPVDGLSGDLTDRVGAIAQVGEKNDRVPTGRRRGHWRAEN"
FT                   /protein_id="YP_003165396.1"
FT   gene            126411..127658
FT                   /db_xref="GeneID:8402231"
FT                   /locus_tag="CAP2UW1_0106"
FT   CDS_pept        126411..127658
FT                   /locus_tag="CAP2UW1_0106"
FT                   /gene_family="HOG000158244" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rxy:Rxyl_0689 glycosyl transferase, group 1"
FT                   /db_xref="GI:257091756"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:8402231"
FT                   /translation="MAIKVLYIDGEGAFGGSSRSLFEAVKAFPEGAVLPYFLATRGTAL
FT                   DFYKQLAVDIITTRGMPRFDNTRYGYYRGVRWLILLRELFYFPFVIVALVRARLRWKDI
FT                   DLVHVNEFVYVLPGLIGKWLFHVPLVVHVRALARFGDGSIRTRVLNSMFSRYVDSVVAI
FT                   DGNVRATIPSDWPVTVINNSFTPGLASSPEKPLVDKLGSLPSGSFKVGFVGNLHRSKGV
FT                   FEIVDAAKLIKTSGREVDFLMVGGVTMDDVGLKAWVLSKMGFAQNVRADLARRVDQEGL
FT                   GGFFHFLGPTLNIKYVYDRLDVLLFPSHFDAPGRPVFEAGFSGVPSIVAVKKPMPDTFI
FT                   PGETGLAVSGRCPAELAKAILYLEANRSEQKRMGSNARRLAEENFDPCKNSKRLLGVYH
FT                   GIVGGKSSAQILRKRG"
FT                   /protein_id="YP_003165397.1"
FT   misc_feature    126411..127625
FT                   /note="Glycosyltransferase [Cell envelope biogenesis, outer
FT                   membrane]; Region: RfaG; COG0438"
FT                   /db_xref="CDD:30787"
FT                   /locus_tag="CAP2UW1_0106"
FT   misc_feature    126507..127604
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases and named after YqgM in
FT                   Bacillus licheniformis about which little is known.
FT                   Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to...; Region:
FT                   GT1_YqgM_like; cd03801"
FT                   /db_xref="CDD:99974"
FT                   /locus_tag="CAP2UW1_0106"
FT   gene            127860..129017
FT                   /db_xref="GeneID:8402232"
FT                   /locus_tag="CAP2UW1_0107"
FT   CDS_pept        127860..129017
FT                   /locus_tag="CAP2UW1_0107"
FT                   /gene_family="HOG000008105" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LPS biosynthesis protein WbpG"
FT                   /transl_table="11"
FT                   /note="KEGG: pap:PSPA7_1978 LPS biosynthesis protein WbpG"
FT                   /db_xref="GI:257091757"
FT                   /db_xref="GeneID:8402232"
FT                   /translation="MTEKPVRSSSWKICAHCVMDTSDPSIAFDESGVCEYCNNYKNEIL
FT                   PNWHTDAQGATELAALADKIRAEGRGKDFDCIIGLSGGLDSSYAAHVAKERMGLRPLLF
FT                   HVDAGWNTNQAVGNIEKLVDGLGLALYTEVINWEEMKDLQLAFLRSQIADQDLPQDAAF
FT                   FSALYMFARKHRIKYVITGANFSTECCREPEEWGGYPGIDTTLFQSIHSRFGQRALKTF
FT                   PLVDIFVYKILYQKLMGMTVVKPLNLVPYIKKDAEAELERRFGWQRFQHKHHESRFTRF
FT                   YEDYWMPRKFGFHKRRAHFSSLILTGQMTRDEALDRLSRPEMDEHFLKQEFEYVANKLD
FT                   LTVAELQEIFEGPNKTYRDYKNKRWAIGVGADVMRRLGLERRLFR"
FT                   /protein_id="YP_003165398.1"
FT   misc_feature    128076..128600
FT                   /note="This is a subfamily of Adenine nucleotide alpha
FT                   hydrolases superfamily.Adeninosine nucleotide alpha
FT                   hydrolases superfamily  includes N type ATP PPases and ATP
FT                   sulphurylases. It forms a apha/beta/apha fold which  binds
FT                   to Adenosine group.  This...; Region: Alpha_ANH_like_III;
FT                   cd01996"
FT                   /db_xref="CDD:30183"
FT                   /locus_tag="CAP2UW1_0107"
FT   misc_feature    128082..128948
FT                   /note="tRNA(Ile)-lysidine synthase MesJ [Cell cycle
FT                   control, cell division, chromosome partitioning]; Region:
FT                   MesJ; COG0037"
FT                   /db_xref="CDD:30386"
FT                   /locus_tag="CAP2UW1_0107"
FT   misc_feature    order(128094..128102,128106..128117,128172..128174,
FT                   128178..128180)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30183"
FT                   /locus_tag="CAP2UW1_0107"
FT   gene            129014..129628
FT                   /db_xref="GeneID:8402233"
FT                   /locus_tag="CAP2UW1_0108"
FT   CDS_pept        129014..129628
FT                   /locus_tag="CAP2UW1_0108"
FT                   /gene_family="HOG000025030" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: bba:Bd1691 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="GI:257091758"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR012998"
FT                   /db_xref="GeneID:8402233"
FT                   /translation="MIHIVDYGLGNTQAFVNMYKRLGIEAVRAASGAELRGASKLILPG
FT                   VGAFDHAMELLDASGMCQPLEWLVREDKVPVLGICVGMQLLAGSSDEGVSAGLGWVDGR
FT                   VRSFAGNPASVALPMPHMGWNDVIPAAGSPLFKGLEEDARFYFLHSFYFECSDPASVAA
FT                   RADYGFQFHCAVQNGNVFGVQFHPEKSHHWGAALLKNFADL"
FT                   /protein_id="YP_003165399.1"
FT   misc_feature    129014..129625
FT                   /note="imidazole glycerol phosphate synthase subunit HisH;
FT                   Provisional; Region: hisH; PRK13181"
FT                   /db_xref="CDD:183878"
FT                   /locus_tag="CAP2UW1_0108"
FT   misc_feature    129017..129616
FT                   /note="Type 1 glutamine amidotransferase (GATase1) domain
FT                   found in imidazole glycerol phosphate synthase (IGPS);
FT                   Region: GATase1_IGP_Synthase; cd01748"
FT                   /db_xref="CDD:153219"
FT                   /locus_tag="CAP2UW1_0108"
FT   misc_feature    order(129131..129154,129245..129259,129569..129571,
FT                   129575..129577)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:153219"
FT                   /locus_tag="CAP2UW1_0108"
FT   misc_feature    129131..129154
FT                   /note="oxyanion strand; other site"
FT                   /db_xref="CDD:153219"
FT                   /locus_tag="CAP2UW1_0108"
FT   misc_feature    order(129251..129253,129569..129571,129575..129577)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:153219"
FT                   /locus_tag="CAP2UW1_0108"
FT   gene            129630..130427
FT                   /db_xref="GeneID:8402234"
FT                   /locus_tag="CAP2UW1_0109"
FT   CDS_pept        129630..130427
FT                   /locus_tag="CAP2UW1_0109"
FT                   /gene_family="HOG000224612" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidine biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="PFAM: histidine biosynthesis protein; KEGG:
FT                   gur:Gura_1692 imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="GI:257091759"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="GeneID:8402234"
FT                   /translation="MLRPRIIPCLLVHQGGLVKTVEFKDPKYVGDPINAVKIFNEKEAD
FT                   ELVVLDIDASVNGAEPDYRMIANLAAECRMPLCYGGGVHTPKQAKTIIGLGVEKVAMSA
FT                   AAADDATLVTRTADAIGRQSVVVVLDVRRKNGLFAKGYEVFTHNGKRSTKTDPFELAQA
FT                   MQAAGAGEIVINSIDRDGQMKGYDLTLAARMRRELRIPLSFLGGAGSYQDIEALLGECG
FT                   VVGASAGSLFVFKGPYRAVLINYPNPEQKNGICRSGLAAYSSK"
FT                   /protein_id="YP_003165400.1"
FT   misc_feature    129630..130367
FT                   /note="Imidazoleglycerol-phosphate synthase [Amino acid
FT                   transport and metabolism]; Region: HisF; COG0107"
FT                   /db_xref="CDD:30456"
FT                   /locus_tag="CAP2UW1_0109"
FT   misc_feature    129639..130376
FT                   /note="The cyclase subunit of imidazoleglycerol phosphate
FT                   synthase (HisF). Imidazole glycerol phosphate synthase
FT                   (IGPS) catalyzes the fifth step of histidine biosynthesis,
FT                   the formation of the imidazole ring. IGPS converts
FT                   N1-(5'-phosphoribulosyl)-formimino-5-; Region: HisF;
FT                   cd04731"
FT                   /db_xref="CDD:73393"
FT                   /locus_tag="CAP2UW1_0109"
FT   misc_feature    order(129684..129686,129777..129779,129873..129875,
FT                   129936..129941,130011..130013,130017..130019,
FT                   130071..130073,130152..130154,130167..130172,
FT                   130242..130250,130314..130319)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73393"
FT                   /locus_tag="CAP2UW1_0109"
FT   misc_feature    order(129747..129749,129762..129764,129828..129830,
FT                   129840..129842,129849..129851,129855..129857,
FT                   129912..129914,129921..129926,129996..129998,
FT                   130140..130142,130224..130226,130299..130301)
FT                   /note="glutamase interaction surface; other site"
FT                   /db_xref="CDD:73393"
FT                   /locus_tag="CAP2UW1_0109"
FT   gene            130438..131466
FT                   /db_xref="GeneID:8402235"
FT                   /locus_tag="CAP2UW1_0110"
FT   CDS_pept        130438..131466
FT                   /locus_tag="CAP2UW1_0110"
FT                   /gene_family="HOG000257079" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; Polysaccharide
FT                   biosynthesis domain protein; KEGG: pen:PSEEN1500
FT                   polysaccharide biosynthesis protein; O-antigen biosynthesis
FT                   protein"
FT                   /db_xref="GI:257091760"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="GeneID:8402235"
FT                   /translation="MFKNKTLLITGGTGSFGNAVLRRFLDSDLREIRIFSRDEKKQDDM
FT                   RKRYHDAKLMFYMGDVRDYQSVLNAMRSVDFVFHAAALKQVPSCEFHPLEAVKTNVLGT
FT                   ENVLEAAINCGVKRVVCLSTDKAVYPINAMGISKAMMEKVMVAKSRGSSETVICGTRYG
FT                   NVMASRGSVIPLFIEQIRAGKPITITDPNMTRFMMTLDSAVDLVLYAFKHGNSGDIVVQ
FT                   KAPAATVATLAKALTWMLGVPNHEICVIGTRHGEKLYEALLSREERVAAEDMGGYYRVP
FT                   PDLRDLNYGKFVEEGEPKISVSEDYNSHNTERLEVEELKQLLLRLRFMQAIVRGENAHP
FT                   EE"
FT                   /protein_id="YP_003165401.1"
FT   misc_feature    130456..131283
FT                   /note="Polysaccharide biosynthesis protein; Region:
FT                   Polysacc_synt_2; pfam02719"
FT                   /db_xref="CDD:145720"
FT                   /locus_tag="CAP2UW1_0110"
FT   misc_feature    130462..130941
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0110"
FT   misc_feature    131284..131427
FT                   /note="Polysaccharide biosynthesis protein C-terminal;
FT                   Region: Polysacc_syn_2C; pfam08485"
FT                   /db_xref="CDD:149510"
FT                   /locus_tag="CAP2UW1_0110"
FT   gene            131470..131740
FT                   /db_xref="GeneID:8402236"
FT                   /locus_tag="CAP2UW1_0111"
FT                   /pseudo
FT   gene            131743..131952
FT                   /db_xref="GeneID:8402237"
FT                   /locus_tag="CAP2UW1_0112"
FT                   /pseudo
FT   gene            131982..133094
FT                   /db_xref="GeneID:8402238"
FT                   /locus_tag="CAP2UW1_0113"
FT   CDS_pept        131982..133094
FT                   /locus_tag="CAP2UW1_0113"
FT                   /gene_family="HOG000229727" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ppg:PputGB1_1374 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="GI:257091761"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="GeneID:8402238"
FT                   /translation="MTMRVLVTGSKGFVGTNLTVRLGELACYEAIGFAREDSLDDLAER
FT                   VGRADAVVHLAGVNRPKDIKEFAEGNANLTAELCDLIAATGRRIPLIISSSVQADLDNP
FT                   YGESKRGAEVAGETLAERTGNPVSIYRLPGVFGKWCRPNYNSVVATFCHNIANDLPIQI
FT                   SDTAFALSLVYVDDVVGEFIRALDAMPAGLSRGEVSTVYGITLGDLAAQIEAFKNCRES
FT                   LVSERVGAGLVRALYATYVSYLPPAKFAYDLPKYGDERGVFVEMLKTQDSGQFSFFTAH
FT                   PGITRGGHYHHTKTEKFLVIKGSARFGFRHIVTNEPYEVFTSGDRPQVVETVPGWTHDI
FT                   TNIGGEEMVVMLWANEIFDRAQPDTIACKV"
FT                   /protein_id="YP_003165402.1"
FT   misc_feature    131988..132767
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="CAP2UW1_0113"
FT   misc_feature    132735..133082
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:186830"
FT                   /locus_tag="CAP2UW1_0113"
FT   gene            133096..134229
FT                   /db_xref="GeneID:8402239"
FT                   /locus_tag="CAP2UW1_0114"
FT   CDS_pept        133096..134229
FT                   /locus_tag="CAP2UW1_0114"
FT                   /gene_family="HOG000076047" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   pen:PSEEN1502 UDP-N-acetylglucosamine 2-epimerase Wbjd"
FT                   /db_xref="GI:257091762"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="GeneID:8402239"
FT                   /translation="MKKMKVLTVVGTRPEIIRLSRVLAKLDEHCEHVLVHTGQNYDYEL
FT                   NQIFFDDLGIRRPDHFLNAAGATGAETIGKVIIAVDGVLGVENPDAMLVLGDTNSCMAV
FT                   IPAKRRKIPVFHMEAGNRCFDMRVPEEINRRIVDHTADINLTYSTIARDYLLREGLAPD
FT                   TVIKTGSPMFEVLTYYRQGIEESDVLTRLQLEAGRFFVVSAHREENVDSEKNFGKLVGV
FT                   LNRIAEHYGYPVIVSTHPRTQKRVDAMGVVFHSLVRLLKPLGFKDYNKLQMMAKAVLSD
FT                   SGTITEESSILGFAALNIREAHERPEGMEEAAVMMVGLEEVRIMQALQILEAEFSSSSA
FT                   RSVRPIADYSMPNVSEKVVRLIHSYADYVGRVVWKRY"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165403.1"
FT   misc_feature    133096..134220
FT                   /note="UDP-N-acetylglucosamine 2-epimerase [Cell envelope
FT                   biogenesis, outer membrane]; Region: WecB; COG0381"
FT                   /db_xref="CDD:30730"
FT                   /locus_tag="CAP2UW1_0114"
FT   misc_feature    133108..134181
FT                   /note="Bacterial members of the UDP-N-Acetylglucosamine
FT                   (GlcNAc) 2-Epimerase  family are known to catalyze the
FT                   reversible interconversion of UDP-GlcNAc and
FT                   UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to
FT                   produce an activated form of ManNAc residues...; Region:
FT                   GT1_UDP-GlcNAc_2-Epimerase; cd03786"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="CAP2UW1_0114"
FT   misc_feature    order(133132..133134,133882..133884,133888..133890,
FT                   133897..133899,133945..133947,133957..133959)
FT                   /note="active site"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="CAP2UW1_0114"
FT   misc_feature    order(133306..133308,133312..133317,133336..133338,
FT                   133420..133422,133426..133428,133432..133434,
FT                   133483..133485,133495..133497,133564..133566)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="CAP2UW1_0114"
FT   gene            134242..135489
FT                   /db_xref="GeneID:8402240"
FT                   /locus_tag="CAP2UW1_0115"
FT   CDS_pept        134242..135489
FT                   /locus_tag="CAP2UW1_0115"
FT                   /gene_family="HOG000017054" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase group 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pap:PSPA7_1983 glycosyltransferase"
FT                   /db_xref="GI:257091763"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:8402240"
FT                   /translation="MRILVVSQYFWPENFRVNDLVSELGTRGHQVTVLTGYPNYPSGEV
FT                   FPEFRSNPADYSEYAAAKVVRVPLLPRGSGGLRLLLNYLSFALSASVLGAWRLRGQIFD
FT                   VIFVFEPSPITVGLPAVLLRALKRAPVAFWVLDLWPETLEALGVVRSPAVIKLVGRLVS
FT                   FIYNRCDLVLAQSRSFIPQIRKYCAGDKRVEYFPSWSDSDFALSAVQPAAEVPAAEGVF
FT                   SVMFAGNMGDAQDFPAILDAAEIVKHDRKVRWLIVGDGRASGWVKAEVERRGLGESFLL
FT                   LGRHPVERMPSFYKHADALLMSLQDKPIFAMTIPGKLQSYLAAGIPVLAMLNGEGADIV
FT                   RRCGAGVACPAGDGRALAAAVRELAGRQRQELMAMGARGAVLSQTEFDRATLISRLLSA
FT                   FTCLAEGRPEWQEVSE"
FT                   /protein_id="YP_003165404.1"
FT   misc_feature    134242..135462
FT                   /note="putative glycosyl transferase; Provisional; Region:
FT                   PRK10307"
FT                   /db_xref="CDD:182369"
FT                   /locus_tag="CAP2UW1_0115"
FT   misc_feature    134245..135432
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases. wbuB in E. coli is involved
FT                   in the biosynthesis of the O26 O-antigen.  It has been
FT                   proposed to function as an N-acetyl-L-fucosamine (L-FucNAc)
FT                   transferase; Region: GT1_wbuB_like; cd03794"
FT                   /db_xref="CDD:99968"
FT                   /locus_tag="CAP2UW1_0115"
FT   gene            135486..136451
FT                   /db_xref="GeneID:8402241"
FT                   /locus_tag="CAP2UW1_0116"
FT   CDS_pept        135486..136451
FT                   /locus_tag="CAP2UW1_0116"
FT                   /gene_family="HOG000167991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: pol:Bpro_3986 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="GI:257091764"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:8402241"
FT                   /translation="MILVTGATGFVGRALCAALIRSGSIRIAVRNTAGESPADGVDVVR
FT                   GELSATADWSAAMAGVVAVVHCAARVHVMNDDAVDPLAEFRRINVEGSLQLARQAAAAG
FT                   VRRFVFLSSIKVNGEQTDPGRPFTADQAPGPLDPYGISKMEAEAALRALARETGMAVVI
FT                   IRPPLVYGPAVKGNFLAMMRALWRGIPLPLGAVTANRRSLVALDNLVDLIVTCIAHPAA
FT                   ANQTFLVSDAEDLSTAALLRRMGQALGRPARLLPVPVGILRLAATLLGRPGIAQRLCGS
FT                   LEVDIDKTRHLLGWSPPLSVDQGLQRTAAHWMTAPQSARR"
FT                   /protein_id="YP_003165405.1"
FT   misc_feature    135486..136427
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="CAP2UW1_0116"
FT   misc_feature    135495..136124
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0116"
FT   gene            136473..137039
FT                   /db_xref="GeneID:8402242"
FT                   /locus_tag="CAP2UW1_0117"
FT   CDS_pept        136473..137039
FT                   /locus_tag="CAP2UW1_0117"
FT                   /gene_family="HOG000153661" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: sugar transferase; KEGG: pna:Pnap_3481 sugar
FT                   transferase"
FT                   /db_xref="GI:257091765"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="GeneID:8402242"
FT                   /translation="MSMKRFFDLLLGLCTATVLALPILIVAVLVRLTSRGPALYWSDRV
FT                   GKGNAIFRMPKFRSMRVGAPTVATHLLQNPEAYLTPIGSFLRRSSLDELPQLWSILVGD
FT                   MSFVGPRPALFNQQDLVALRTEYGVHRLLPGLTGWAQVNGRDELPIPEKVRLDVEYLQR
FT                   ASLTFDIHILWLTAVKVLRREGVSH"
FT                   /protein_id="YP_003165406.1"
FT   sig_peptide     136473..136535
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.514 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_0117"
FT   misc_feature    136482..137021
FT                   /note="Bacterial sugar transferase; Region: Bac_transf;
FT                   cl00939"
FT                   /db_xref="CDD:154099"
FT                   /locus_tag="CAP2UW1_0117"
FT   gene            137151..139082
FT                   /db_xref="GeneID:8402243"
FT                   /locus_tag="CAP2UW1_0118"
FT   CDS_pept        137151..139082
FT                   /locus_tag="CAP2UW1_0118"
FT                   /gene_family="HOG000257078" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: mms:mma_2254
FT                   nucleoside-diphosphate sugar epimerases"
FT                   /db_xref="GI:257091766"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:8402243"
FT                   /translation="MMKAFLSLSRGRKQAVAIVTDFALLLLALWSALALRFETWTPSFA
FT                   TYGWQVLAAPLLAIPIFIRLGLYRAVIRFMEDRVVFVVTGGVALSVVLLAAGIALTHTP
FT                   GLSRGVLGIYCMLAILYVGTARFLARSYFLRAERAEDSRKRVAIYGAGSAGTQLAYALR
FT                   AGREYLPVAFVDDNAALQRIEVAGLRVQSPDQLMPMMAAGRIEEVLLAIPSASRSRRAE
FT                   IIGSLEGLHCKVRLVPGMADVVSGNVTADAIREVEIEDLLGRESVAPDAALLGRCVTGK
FT                   VVMVSGAGGSIGAELCRQIVQLRPSRLVLMERSEFALYSIEQELATLCVGGSACVELVP
FT                   VLGSVLHQKRNEMVMKSFGVQTVYHAAAYKHVPLVEHNPIEGLRNNAVGTRRMAEAALA
FT                   AGVGTFVLISTDKAVRPTNVMGASKRLAELILQALARSGGGTRFCMVRFGNVLGSSGSV
FT                   VPLFRRQIAAGGPITLTHAEITRYFMTIPEAAQLVIQAGSMGEGGEVYVLDMGKPVRII
FT                   DLARRMVHLSGLEVRDEEHPDGDIAIEVVGLRPGEKLYEELLIGENVEGTTHPLIMRAH
FT                   EHELPWALLAERLAVMDDACQRFDYEQALALLVSLVKEYSPAPHGDGDGELLWNAMTRP
FT                   GRGEVVVH"
FT                   /protein_id="YP_003165407.1"
FT   misc_feature    137301..139019
FT                   /note="Predicted nucleoside-diphosphate sugar epimerases
FT                   [Cell envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: COG1086"
FT                   /db_xref="CDD:31283"
FT                   /locus_tag="CAP2UW1_0118"
FT   misc_feature    137988..>138134
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0118"
FT   misc_feature    <138228..138515
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0118"
FT   gene            139104..139529
FT                   /db_xref="GeneID:8402244"
FT                   /locus_tag="CAP2UW1_0119"
FT   CDS_pept        139104..139529
FT                   /locus_tag="CAP2UW1_0119"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   xac:XAC1695 hypothetical protein"
FT                   /db_xref="GI:257091767"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="GeneID:8402244"
FT                   /translation="MSQIQRAQDWEMTAFDLWQKLRAGWRRGVGGAAIGLLVAGLAIAR
FT                   TPPQYEAVAVVQVGPIGQIGQQNGPLRLVPSLPVEPPANAVERIKTAASQSSVAEHPGN
FT                   QAWIDALRASPSVCAAYLSAQVAQDDRQSAGVGIRVD"
FT                   /protein_id="YP_003165408.1"
FT   gene            139629..140015
FT                   /db_xref="GeneID:8402245"
FT                   /locus_tag="CAP2UW1_0120"
FT   CDS_pept        139629..140015
FT                   /locus_tag="CAP2UW1_0120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091768"
FT                   /db_xref="GeneID:8402245"
FT                   /translation="MARMQVALALARAKLASAEMETESLNRFVANAGIKDDRFTQLSLL
FT                   TSLRLQKESEFFNQGPIVSMLEAALNPPATQSSEAIEPVFVSDKPVSPTKGLLLALGLI
FT                   GGLFAGVVSVCLPAMPGGARELNA"
FT                   /protein_id="YP_003165409.1"
FT   gene            140097..141995
FT                   /db_xref="GeneID:8402246"
FT                   /locus_tag="CAP2UW1_0121"
FT   CDS_pept        140097..141995
FT                   /locus_tag="CAP2UW1_0121"
FT                   /gene_family="HOG000219835" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver;
FT                   Metal-dependent hydrolase HDOD; KEGG: tbd:Tbd_2023 response
FT                   regulator receiver modulated diguanylate cyclase"
FT                   /db_xref="GI:257091769"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="GeneID:8402246"
FT                   /translation="MNTIEQLRLSGRLPSPKGVALAIMEITRREETTLDEVARVVQSDP
FT                   ALSSRLLRLSNAAARGRPVVSISEAVMRLGMATVRRLAMAFSLVDQYLEGPCPSFDYPG
FT                   FWSHSLFMAVASQELGRLLPAASPDELFACGLLAQVGSLALVTVYPADYARLLTESCHG
FT                   VALMELERRRLGVDHSEFTVAIMADCGIPKALTEPVYYHEVPETSGFAEGSRPYQLVNL
FT                   FFQARRMADLGRSAVTEPHGSISELMLLGGKIGLDATALGEVFDQVVRQWQEWAELLKV
FT                   PVGHLPSFDAMANAPVPRPEQEAAATGTRQVVLLVEDDPTTRMMTEGVLSHLLGCTVHT
FT                   AENGREALALALEVTPQIVVTDWLMPVMDGLEFCRALRATDWGQSMYVIMLTGEETEEK
FT                   IIEAFEAGVDDYVTKPVNVRALSARMRAALHYVKLLDAWERDRAQLKQFAAELATSNRR
FT                   LEHAAMTDLLTDLPNRRAGMESLARFWSASMRTGQPVAALMIDVDFFKSVNDRHGHAVG
FT                   DRVLQEVARAIQSAARKDDSVSRIGGEEFLLVCHDADPRAALLAAERLRRMVKALKISV
FT                   GGVDIQVSVSVGVASREAGMESEDDMLRAADKALYAAKNAGRDRVCLFALGKARCA"
FT                   /protein_id="YP_003165410.1"
FT   misc_feature    140133..140711
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:185790"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    141036..141383
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    order(141045..141050,141180..141182,141204..141206,
FT                   141270..141272,141327..141329,141336..141341)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    141180..141182
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    order(141189..141194,141198..141206)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    141336..141344
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    141486..141962
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    order(141597..141599,141726..141728)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    order(141612..141614,141621..141626,141636..141638,
FT                   141648..141650,141714..141716,141720..141731)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0121"
FT   misc_feature    order(141702..141704,141786..141788)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0121"
FT   gene            142173..143582
FT                   /db_xref="GeneID:8402247"
FT                   /locus_tag="CAP2UW1_0122"
FT   CDS_pept        142173..143582
FT                   /locus_tag="CAP2UW1_0122"
FT                   /gene_family="HOG000229265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="KEGG: dar:Daro_3211 exodeoxyribonuclease VII large
FT                   subunit; TIGRFAM: exodeoxyribonuclease VII, large subunit;
FT                   PFAM: Exonuclease VII large subunit; nucleic acid binding
FT                   OB-fold tRNA/helicase-type"
FT                   /db_xref="GI:257091770"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="GeneID:8402247"
FT                   /translation="MSDIPSPATGLPAFVPVIAVSLLNRLARERLEAAFPLCWVAGEVS
FT                   NLSHAASGHVYFSLKDAAAQVRCVMFRSRTQLLGWRLENGQHIEARVLVTLYEARGDFQ
FT                   LNVEAARRAGVGNLYEKFLRLKEKLESEGLFASAGKRPLPGFPRRIGIVTSLQAAALRD
FT                   VLSTLARRAPQVGIVVYPTLVQGEGAASQIAESIRIAGERRECETLIVCRGGGSMEDLW
FT                   AFNDELVARAIRACPIPVVSGIGHETDFTIADFAADQRAPTPTAAAELAAPEQLVLLAR
FT                   LAARQLALRRSVDQQINQRGQQLDWLTRRLQHPAQYLAHQREVLRNQQRQLAAALLQAS
FT                   ARARTALADLSRRLLLARPETSRRTGQVEALAARLRGAWQQAAQRQGADLARLTASLAH
FT                   LNPAAVLARGYCVALDERGRIVRDSRSVEPSQRIAVFFERGRADAAVLAVFPDGGLAPA
FT                   VAAIASKAGPE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165411.1"
FT   misc_feature    142218..143510
FT                   /note="exodeoxyribonuclease VII large subunit; Reviewed;
FT                   Region: xseA; PRK00286"
FT                   /db_xref="CDD:178962"
FT                   /locus_tag="CAP2UW1_0122"
FT   misc_feature    142284..142514
FT                   /note="ExoVII_LU_OBF: A subfamily of OB folds corresponding
FT                   to the N-terminal OB-fold domain of Escherichia coli
FT                   exodeoxyribonuclease VII (ExoVII) large subunit. E. coli
FT                   ExoVII is composed of two non-identical subunits. E. coli
FT                   ExoVII is a single-strand-...; Region: ExoVII_LU_OBF;
FT                   cd04489"
FT                   /db_xref="CDD:72961"
FT                   /locus_tag="CAP2UW1_0122"
FT   misc_feature    order(142287..142289,142431..142433,142437..142439,
FT                   142443..142445,142503..142505)
FT                   /note="generic binding surface II; other site"
FT                   /db_xref="CDD:72961"
FT                   /locus_tag="CAP2UW1_0122"
FT   misc_feature    order(142302..142310,142338..142349,142353..142355,
FT                   142371..142379,142383..142385,142428..142430,
FT                   142449..142457,142482..142490)
FT                   /note="generic binding surface I; other site"
FT                   /db_xref="CDD:72961"
FT                   /locus_tag="CAP2UW1_0122"
FT   gene            143673..144260
FT                   /db_xref="GeneID:8402248"
FT                   /locus_tag="CAP2UW1_0123"
FT   CDS_pept        143673..144260
FT                   /locus_tag="CAP2UW1_0123"
FT                   /gene_family="HOG000013584" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   dar:Daro_3212 manganese and iron superoxide dismutase"
FT                   /db_xref="GI:257091771"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="GeneID:8402248"
FT                   /translation="MEHQLPQLPFAMDALAPHMSRETFEYHYAKHHQAYVTNLNNLIKG
FT                   TEYEALDLEAIIRKAPAGGVYNNSAQVWNHTFFWNCLTPNGGGAPGGALAAAIDAKWGS
FT                   FAEFSKAFQTSAVGNFGSAWTWLVKKADGSVDIVNMGAAGTPLTTGDKALLCIDVWEHA
FT                   YYIDYRNLRPKYVETFLASLANWRFAEQNFAG"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165412.1"
FT   misc_feature    143673..144257
FT                   /note="superoxide dismutase; Provisional; Region: PRK10543"
FT                   /db_xref="CDD:182534"
FT                   /locus_tag="CAP2UW1_0123"
FT   misc_feature    143676..143921
FT                   /note="Iron/manganese superoxide dismutases, alpha-hairpin
FT                   domain; Region: Sod_Fe_N; pfam00081"
FT                   /db_xref="CDD:109149"
FT                   /locus_tag="CAP2UW1_0123"
FT   misc_feature    143982..144248
FT                   /note="Iron/manganese superoxide dismutases, C-terminal
FT                   domain; Region: Sod_Fe_C; pfam02777"
FT                   /db_xref="CDD:145761"
FT                   /locus_tag="CAP2UW1_0123"
FT   gene            complement(144337..144816)
FT                   /db_xref="GeneID:8402249"
FT                   /locus_tag="CAP2UW1_0124"
FT   CDS_pept        complement(144337..144816)
FT                   /locus_tag="CAP2UW1_0124"
FT                   /gene_family="HOG000106483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-strand binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: azo:azo3385 single-strand DNA-binding protein"
FT                   /db_xref="GI:257091772"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="GeneID:8402249"
FT                   /translation="MASVNKVILVGNLGADPETRYSANGDAICNIRMATTDRFRDKASG
FT                   ELKDSTEWHRVVFFGKLAETAGQYLKKGRQIYVEGRIRTNKWQDKDGNERYTTEIIANE
FT                   MKMLGSREGMGSPASSESEYGGSMPSSAAPASGAARSAPAKKTPSFDDMDDDIPF"
FT                   /protein_id="YP_003165413.1"
FT   misc_feature    complement(144493..144798)
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="CAP2UW1_0124"
FT   misc_feature    complement(order(144523..144525,144532..144534,
FT                   144565..144567,144592..144594,144655..144657,
FT                   144661..144663,144706..144714,144787..144798))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="CAP2UW1_0124"
FT   misc_feature    complement(order(144514..144516,144520..144522,
FT                   144559..144564,144568..144570,144574..144576,
FT                   144598..144603,144640..144642,144646..144648,
FT                   144652..144654,144658..144660,144664..144669,
FT                   144703..144708,144727..144729,144757..144759,
FT                   144775..144783))
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="CAP2UW1_0124"
FT   misc_feature    complement(order(144499..144501,144580..144582,
FT                   144586..144588,144592..144594))
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="CAP2UW1_0124"
FT   gene            complement(144867..146072)
FT                   /db_xref="GeneID:8402250"
FT                   /locus_tag="CAP2UW1_0125"
FT   CDS_pept        complement(144867..146072)
FT                   /locus_tag="CAP2UW1_0125"
FT                   /gene_family="HOG000264695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: eba:ebA3858 putative
FT                   MFS family transporter"
FT                   /db_xref="GI:257091773"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:8402250"
FT                   /translation="MSVSTTDRMSSDEKRAGVSLAAVFALRMLGLFLILPVFAIYAKEL
FT                   PSGNDVALVGIALGAYGLTQACLQIAYGAASDRFGRKPVIVFGLIVFVIGSFVAAFAGD
FT                   IYIVIAGRVLQGAGAISAAVTALAADLTREQHLTKVMAMIGSSIGLVFAISMVGAPLLF
FT                   VSIGMPGIFALTGILALLAIFVVIRVVPAAPAVPRQPTWQSFVEVLAHRQLLRLNFGVF
FT                   ALHLMLTAMWVLLPAELISTGGLPVAEHWKVYLPALLLSFVIMVPAIIVAERFSRMKLI
FT                   FNAAIVLLLLVQFGFGLFSAGLYGLAFWLTLFFVAFNILEATQPSLISRIAPPHAKGAA
FT                   LGVYNTTQALGLFLGGVFGGVLAKYAGPGAVWAGGAALALVWLMLGLSMSIPPLRTRQQ
FT                   AA"
FT                   /protein_id="YP_003165414.1"
FT   misc_feature    complement(145026..146021)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="CAP2UW1_0125"
FT   misc_feature    complement(145026..146015)
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="CAP2UW1_0125"
FT   misc_feature    complement(order(145026..145031,145038..145043,
FT                   145050..145055,145086..145088,145095..145100,
FT                   145110..145112,145119..145124,145131..145133,
FT                   145278..145280,145290..145292,145299..145301,
FT                   145311..145313,145323..145325,145365..145367,
FT                   145374..145379,145386..145391,145398..145400,
FT                   145617..145619,145635..145640,145647..145652,
FT                   145686..145688,145695..145700,145707..145712,
FT                   145719..145724,145854..145859,145863..145868,
FT                   145878..145880,145887..145892,145899..145901,
FT                   145956..145961,145965..145973,145980..145982))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="CAP2UW1_0125"
FT   gene            146143..149016
FT                   /db_xref="GeneID:8402251"
FT                   /locus_tag="CAP2UW1_0126"
FT   CDS_pept        146143..149016
FT                   /locus_tag="CAP2UW1_0126"
FT                   /gene_family="HOG000050448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="excinuclease ABC, A subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: dar:Daro_0473 excinuclease ABC
FT                   subunit A"
FT                   /db_xref="GI:257091774"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="GeneID:8402251"
FT                   /translation="MDETREIRIRGARTHNLKNVSLDLPRNRLIVITGLSGSGKSSLAF
FT                   DTLYAEGQRRYVESLSAYARQFLQRMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTV
FT                   TEIHDYLRLLFARAGTPYCAEHQQPLEAQTVSQMVDHVLALPEGTRLMILAPVVANRKG
FT                   EQLELFAELRAQGFARLRVDGQIHEIDALPKLAKTHKHTVDVVVDRLKVREDLRQRLAE
FT                   SFETALRHADGRAIAYEMDNEHEHFFSAKFACPVCSYSIQELEPRIFSFNSPMGACQKC
FT                   DGLGVIQFFDPKRIVVRPELSLAAGAIRGWDRRNPFYFQMLCSLAEHYGFAVDTPFDAL
FT                   PDNVRQVVLYGSGRQELPFSYVNERGRPSVRQHAFEGIVVNLERRYKETDSNAVREELA
FT                   RLISNRTCPACHGSRLREEARNVRVGVRASARTLHEINRLPLAEARAYFLALQLPGNKA
FT                   QIAEKVLKEIVSRLQFLIDVGLDYLSLDRSAETLSGGEAQRIRLASQIGSGLTGVMYVL
FT                   DEPSIGLHQRDNERLLKTLKRLRDIGNTVIVVEHDEEAIRGADYVVDIGPGAGVHGGYV
FT                   VAEGVPQAIIDNPASLTGDFLAGRRCIAMRAVRRQPEAGRVLQIIGARGNNLRDVSVDI
FT                   PLGLLTCVTGVSGSGKSTLINDTLYTAAARHLYGASSEAAEHDRIVGLEYFDKVINVDQ
FT                   SPIGRTPRSNPATYTGLLTPIRELFAGVPESRSRGYGPGRFSFNVKGGRCEACQGDGVL
FT                   KVEMHFLPDVYVPCDVCHGKRYNRETLEVQYKGRNIHEVLQMTVEVARAFFDAVPVVAR
FT                   KLQTLVDVGLSYITLGQAATTLSGGEAQRVKLALELSKRDTGRTLYILDEPTTGLHFQD
FT                   IEMLLTVLHRLVDHGNTVVVIEHNLDVIKTADWLIDLGPEGGAGGGRILAVGTPERVAL
FT                   EEESHSGRFLRPLLMRRREASAARLGE"
FT                   /protein_id="YP_003165415.1"
FT   misc_feature    146161..148980
FT                   /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
FT                   PRK00349"
FT                   /db_xref="CDD:178984"
FT                   /locus_tag="CAP2UW1_0126"
FT   misc_feature    146161..>146499
FT                   /note="The excision repair protein UvrA domain I;
FT                   Nucleotide excision repair in eubacteria is a process that
FT                   repairs DNA damage by the removal of a 12-13-mer
FT                   oligonucleotide containing the lesion.  Recognition and
FT                   cleavage of the damaged DNA is a multistep...; Region:
FT                   ABC_UvrA_I; cd03270"
FT                   /db_xref="CDD:73029"
FT                   /locus_tag="CAP2UW1_0126"
FT   misc_feature    <147544..147882
FT                   /note="The excision repair protein UvrA domain I;
FT                   Nucleotide excision repair in eubacteria is a process that
FT                   repairs DNA damage by the removal of a 12-13-mer
FT                   oligonucleotide containing the lesion.  Recognition and
FT                   cleavage of the damaged DNA is a multistep...; Region:
FT                   ABC_UvrA_I; cd03270"
FT                   /db_xref="CDD:73029"
FT                   /locus_tag="CAP2UW1_0126"
FT   misc_feature    147994..148917
FT                   /note="The excision repair protein UvrA domain II;
FT                   Nucleotide excision repair in eubacteria is a process that
FT                   repairs DNA damage by the removal of a 12-13-mer
FT                   oligonucleotide containing the lesion.  Recognition and
FT                   cleavage of the damaged DNA is a multistep...; Region:
FT                   ABC_UvrA_II; cd03271"
FT                   /db_xref="CDD:73030"
FT                   /locus_tag="CAP2UW1_0126"
FT   gene            149262..149546
FT                   /db_xref="GeneID:8402252"
FT                   /locus_tag="CAP2UW1_0127"
FT   CDS_pept        149262..149546
FT                   /locus_tag="CAP2UW1_0127"
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone family protein DNA-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: tbd:Tbd_0007 histone-like DNA-binding protein"
FT                   /db_xref="GI:257091775"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="GeneID:8402252"
FT                   /translation="MNKSELIDAIAARSELSKAAAAKALDAVIETIVDSVAQGETVTLV
FT                   GFGSFKASGRASREGKNPKTGEKIHIPETTVPKFSAGATFKARVAGKDV"
FT                   /protein_id="YP_003165416.1"
FT   misc_feature    149265..149525
FT                   /note="Integration host factor (IHF) and HU are small
FT                   heterodimeric members of the DNABII protein family that
FT                   bind and bend DNA, functioning as architectural factors in
FT                   many cellular processes including transcription,
FT                   site-specific recombination, and higher...; Region: HU_IHF;
FT                   cd00591"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_0127"
FT   misc_feature    order(149265..149270,149277..149279,149286..149288,
FT                   149298..149300,149340..149342,149349..149354,
FT                   149361..149366,149376..149390,149397..149402,
FT                   149415..149417,149481..149486,149496..149498,
FT                   149502..149504,149523..149525)
FT                   /note="IHF dimer interface; other site"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_0127"
FT   misc_feature    order(149265..149273,149337..149339,149382..149384,
FT                   149388..149390,149394..149399,149406..149408,
FT                   149418..149420,149424..149429,149433..149435,
FT                   149442..149453,149481..149483,149493..149495,
FT                   149499..149501,149508..149510)
FT                   /note="IHF - DNA interface; other site"
FT                   /db_xref="CDD:29683"
FT                   /locus_tag="CAP2UW1_0127"
FT   gene            149657..150166
FT                   /db_xref="GeneID:8402253"
FT                   /locus_tag="CAP2UW1_0128"
FT   CDS_pept        149657..150166
FT                   /locus_tag="CAP2UW1_0128"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pnu:Pnuc_1628 hypothetical protein"
FT                   /db_xref="GI:257091776"
FT                   /db_xref="GeneID:8402253"
FT                   /translation="MRLCTALATAALALMPLAVSAQQAPAAEALTAVAPGKFAGMIEAK
FT                   VTLVVESIDKATRGVVLKDAKGDQIKIVAGDEVKNFDQIKVGDNVIATYTQGLVITLKK
FT                   GGGALRERIDSGETASAAKGEKPAGYEVKEVTFVALPPIMFRPPERTWEEAVRWQRVSR
FT                   EGGGRV"
FT                   /protein_id="YP_003165417.1"
FT   sig_peptide     149657..149722
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 22"
FT                   /locus_tag="CAP2UW1_0128"
FT   gene            complement(150140..151198)
FT                   /db_xref="GeneID:8402254"
FT                   /locus_tag="CAP2UW1_0129"
FT   CDS_pept        complement(150140..151198)
FT                   /locus_tag="CAP2UW1_0129"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dge:Dgeo_3112 transposase IS4 family protein"
FT                   /db_xref="GI:257091777"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402254"
FT                   /translation="MGKTDKLADEVRFGLEEALPGMRKTILKKLPLAVAAMIQARTPNT
FT                   MELSTLLALNTERADMREQWLRRLLTNRLIRSAGVLEPFARRALEQAAAGGQTILLSMD
FT                   QTDLGDRFAVLMISVRRGDRSLPLVWRIEEGEANIGFAGQQVLLEEVRAWLPEGAAVML
FT                   LADRFYPSVALFEWLLATGWQYRLRLKGNLLVDVGCAGIGTTGELAAGVRERYEANARL
FT                   FEAGIPMAIGVLHEPGHPEPWIIAMDCPPNRAAVRDYGARWAIEPMFSDFKSRGFRLED
FT                   TKLEAPKRLDCLILIMALAMYWCVQAGQEDARCNPTATEKKPVSRPTPTIGVSAKPIAV
FT                   PFPGSNAASAFS"
FT                   /protein_id="YP_003165418.1"
FT   misc_feature    complement(150290..>150769)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="CAP2UW1_0129"
FT   gene            151551..151626
FT                   /note="tRNA-Ala2"
FT                   /db_xref="GeneID:8402255"
FT                   /locus_tag="CAP2UW1_R0003"
FT   tRNA            151551..151626
FT                   /db_xref="GeneID:8402255"
FT                   /locus_tag="CAP2UW1_R0003"
FT                   /product="tRNA-Ala"
FT   gene            151908..153350
FT                   /db_xref="GeneID:8402256"
FT                   /locus_tag="CAP2UW1_0130"
FT   CDS_pept        151908..153350
FT                   /locus_tag="CAP2UW1_0130"
FT                   /gene_family="HOG000133815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_1156 diguanylate cyclase with PAS/PAC
FT                   sensor; TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="GI:257091778"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:8402256"
FT                   /translation="MSDVNSEGHSGDAVAERLAKYVVDALPIPMFAIDAEHRVVFWNAS
FT                   CERITGIPGKFMLRKAGAWSAFYPSRRPVMADLVLTGCRHEDLERYYEGKYRPSVLVEG
FT                   GWECEDFFPQLPAGGKWLAFTAAPLRDGEGRVIGAVETFRDITAQREAERAARDGAVLL
FT                   SEIVQGCPVPMFVIDAEHRVTHWNRACESMAGVPAEQMIGSRQHWWPFYPEPRPVMADL
FT                   VLDAAIGEVEKFYAGKYQPSRLIAGAWEAKDHFPQFPGGGRWLYFTAAPLHGADGRVIG
FT                   AVETLQDISEQKRYEAQLEDQARQDLLTGLANRRVLEERLKQALAQAARDGRVVAVAFI
FT                   DLDHFKPINDEMGHAAGDALLRELATRLTSMVRDVDTVARVGGDEFVVVLSAPESAEAV
FT                   EGVIRRIIDAVGRPVTIAGREVQVGCSVGIALYPDHGTDQAGLLRDADTAMYIAKAAGR
FT                   NGYHVHCQSADVPPPLGDSPAP"
FT                   /protein_id="YP_003165419.1"
FT   misc_feature    <151956..>152804
FT                   /note="hypothetical protein; Provisional; Region: PRK13560"
FT                   /db_xref="CDD:106506"
FT                   /locus_tag="CAP2UW1_0130"
FT   misc_feature    151971..>152087
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="CAP2UW1_0130"
FT   misc_feature    152394..>152552
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="CAP2UW1_0130"
FT   misc_feature    152817..153293
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0130"
FT   misc_feature    order(152928..152930,153057..153059)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0130"
FT   misc_feature    order(152943..152945,152952..152957,152967..152969,
FT                   152979..152981,153045..153047,153051..153062)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0130"
FT   misc_feature    order(153033..153035,153120..153122)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0130"
FT   gene            153426..153884
FT                   /db_xref="GeneID:8402257"
FT                   /locus_tag="CAP2UW1_0131"
FT   CDS_pept        153426..153884
FT                   /locus_tag="CAP2UW1_0131"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pnu:Pnuc_0542 hypothetical protein"
FT                   /db_xref="GI:257091779"
FT                   /db_xref="GeneID:8402257"
FT                   /translation="MQRPPHFHGLVAGSVLLALASVADAQALFLARRAIGRIEQMAQSS
FT                   PTTGAAYDVATVIVEVTADKVFETVKRLLAQNTQLRVTRSDDAKRSIEFTDGTQIGGIQ
FT                   VNPLNDSLSQMMVSTAHPGIASSTTSTIVARTLAMCRELNVVCEQGQS"
FT                   /protein_id="YP_003165420.1"
FT   sig_peptide     153426..153503
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.644 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_0131"
FT   gene            154602..157529
FT                   /db_xref="GeneID:8402258"
FT                   /locus_tag="CAP2UW1_0132"
FT   CDS_pept        154602..157529
FT                   /locus_tag="CAP2UW1_0132"
FT                   /gene_family="HOG000236782" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, putative ATPase,
FT                   winged helix family"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: mpt:Mpe_A1734 ATPase-like protein"
FT                   /db_xref="GI:257091780"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:8402258"
FT                   /translation="MIERPASGRPKGEPHPLRVRFDRFELDEANARLLRDGTAVALAPR
FT                   PFAVLCALVRHAGSLLTTNALLDEVWGHQFVTDSVLRTAISELRTVLDDDARKPRYIET
FT                   VSRRGYRFVAAPSALAAAPGVQPSVSGFTAAHVPYFIGRAEPLSRLRRTWDTACSGKRA
FT                   VGWIVGEPGIGKTTLIEQFIARLGNVACARGQCVDHYGTAESYLPVLEALDELCRSDSE
FT                   VPSLLRAVAPTWLLQLPWLSTTDEREALRRELAGVSPDRMLREMGQFLDRYTERRPLLL
FT                   VTEDLHWSDRATIQLIDYIARRRGSARIMWLASFRLAEVVALDHPLNPLRHELRLHDLC
FT                   EEIVLDPFSESEVADYVAARSPAIATDEAFVRALHERTDGVALFVASVMTEVITRAEHA
FT                   GDNASAGSQLAKIAVAEHLAAIIDHYIAKLTGDQRLVLSAAAVCGIEFGIPTISGALER
FT                   DAFWVGQTCDELARAQLWLVAPRPQGGNNAAELPYSFRHALFRQVLYEHTNPSIRSQLH
FT                   RKVGTTLERERAAGASVAAAELAMHFELGREPMAALRHYVAAAEAALARLSPRECMNLT
FT                   EHALTLLGQAPEGTQRNALEIALATFHGVAATHVHGISHPEAKIAFQRAYALLADIPDH
FT                   SMRGRLLHGFAFVLSLRADYAEALAVAERAEALSSAPNDPVLVLVTCIVHGYVAQLQGR
FT                   LRAAGTWIERGLVAAELLELAPVEIFVADPQVTLLGLQGIHLLHSGFVEQARARLERAH
FT                   ARALLLGWPNTRLAALWYAALFEVRLGNAERVAALADEMRALVDESKVAQGRTACRWFR
FT                   GWADARMGRPRDGYRRIREAYEDNTQLGMLAGGSEVLGYATEALVLAGDWDGAQHELED
FT                   ALQVANTLGERVYLPQLFVMQAVIGRARGDRAAADAAIRRAIVEARAQEAPWLELMALI
FT                   ELCERHSATAEDRRALAELVDQLPEALDTPAAARARALLAKAKSG"
FT                   /protein_id="YP_003165421.1"
FT   misc_feature    154656..154937
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="CAP2UW1_0132"
FT   misc_feature    order(154728..154730,154785..154790,154839..154841,
FT                   154848..154850,154872..154877,154911..154913,
FT                   154926..154928)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="CAP2UW1_0132"
FT   misc_feature    155019..>156185
FT                   /note="Predicted ATPase [General function prediction only];
FT                   Region: COG3899"
FT                   /db_xref="CDD:33687"
FT                   /locus_tag="CAP2UW1_0132"
FT   gene            157636..157851
FT                   /db_xref="GeneID:8402259"
FT                   /locus_tag="CAP2UW1_0133"
FT   CDS_pept        157636..157851
FT                   /locus_tag="CAP2UW1_0133"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091781"
FT                   /db_xref="GeneID:8402259"
FT                   /translation="MTFNTDCKYPTRRAYVVKVRGDAKPDALAGRLENLVTGRQCEFVS
FT                   GRELLESLASDLDATPHEQPSNAQSE"
FT                   /protein_id="YP_003165422.1"
FT   gene            157905..158240
FT                   /db_xref="GeneID:8402260"
FT                   /locus_tag="CAP2UW1_0134"
FT   CDS_pept        157905..158240
FT                   /locus_tag="CAP2UW1_0134"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rso:RS02287 hypothetical protein"
FT                   /db_xref="GI:257091782"
FT                   /db_xref="GeneID:8402260"
FT                   /translation="MTEPHDHGQIAWWAENIDELDREIARLCLLCQVRILDPGIIERVL
FT                   EKDASVCGTPNPVAFAKLRDMLMFYFVIREKSVDAVGELQTEQIEAHVIEQIRNRFGDL
FT                   LGKWPPA"
FT                   /protein_id="YP_003165423.1"
FT   misc_feature    <157923..>158189
FT                   /note="heterogeneous nuclear ribonucleoprotein R, Q family;
FT                   Region: hnRNP-R-Q; TIGR01648"
FT                   /db_xref="CDD:162463"
FT                   /locus_tag="CAP2UW1_0134"
FT   gene            158253..158699
FT                   /db_xref="GeneID:8402261"
FT                   /locus_tag="CAP2UW1_0135"
FT   CDS_pept        158253..158699
FT                   /locus_tag="CAP2UW1_0135"
FT                   /gene_family="HOG000273982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpt:Rpal_2539 hypothetical protein"
FT                   /db_xref="GI:257091783"
FT                   /db_xref="GeneID:8402261"
FT                   /translation="MDSAIISAMAGVLGSLVGGSAAFATAWITQKTVSQRELIQGDMRK
FT                   RETLYGEFIGECAKLLIDAFVHTLDDPEKLLPLYALTNRIRLTASQPVLAEAERLLSHI
FT                   TDQYFSRNLTVQEMGQLARSVGADPLKAFGEACRAELKLIRARL"
FT                   /protein_id="YP_003165424.1"
FT   sig_peptide     158253..158327
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.668 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_0135"
FT   gene            158788..160290
FT                   /db_xref="GeneID:8402262"
FT                   /locus_tag="CAP2UW1_0136"
FT   CDS_pept        158788..160290
FT                   /locus_tag="CAP2UW1_0136"
FT                   /gene_family="HOG000111956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bph:Bphy_3507 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="GI:257091784"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="GeneID:8402262"
FT                   /translation="MSNPANPSIPFRHFRVLAASVALALAGCTTPVLKPSLDVPDRFGA
FT                   ATAPVDEPEVAWWEGFKDPVLADLIRRAAQENRDVKIAAERLRAARAGETISRSWLFPA
FT                   VGLAGDAFDHKTNYDSVLKSVVPEAANTKAAQIGVGVTWEVDLFGRLRAGAAAAAADTL
FT                   AVENGARGVRLLVLSDVATNYFKLTGALRQLETVRAIAAAQDETLRLVTARQRVGLATA
FT                   FDVERAQTEASRARAAIPPLETLAAVSRHRIAVLIGGQAFRAASITPSTVEATVPPARP
FT                   GQPAALLQRRPDLLAASAQLDAANARRQQAMAEWFPRLVLGAVFGRESIELNGSDLGPA
FT                   RFTNVAAMLAMPIFNAGRTQAINDIAESGQREAVLRYEDAIARALEDVENTLVALADER
FT                   QRAQALNSAAASADAALGRAQSLYDRGQIDLLPLLDAQRVRLSVRVGANDANTQLLLDS
FT                   VQLYKALGGGWQAFEPVAGPAASANPNSPTSSNSVARYKDPS"
FT                   /protein_id="YP_003165425.1"
FT   sig_peptide     158788..158889
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.477 at
FT                   residue 34"
FT                   /locus_tag="CAP2UW1_0136"
FT   misc_feature    158917..160191
FT                   /note="NodT family; Region: outer_NodT; TIGR01845"
FT                   /db_xref="CDD:162557"
FT                   /locus_tag="CAP2UW1_0136"
FT   misc_feature    158983..159561
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_0136"
FT   misc_feature    159640..160185
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_0136"
FT   gene            160287..161405
FT                   /db_xref="GeneID:8402263"
FT                   /locus_tag="CAP2UW1_0137"
FT   CDS_pept        160287..161405
FT                   /locus_tag="CAP2UW1_0137"
FT                   /gene_family="HOG000260606" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bph:Bphy_3506 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="GI:257091785"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:8402263"
FT                   /translation="MNPSPSPTLVIVAMIAVAGLSACTSKPPAEALRAVRTAQIRYDRT
FT                   QEMNRYVGTVQSRHEVNEAFRVGGKVVQRKVDVGQNVREGDVLTVLDDTDYRLAEGAAR
FT                   QQLVAATAQAKQAESDRKRLDALKTDGSVSVSDNEKARTAHETASASAEAAARQLELAR
FT                   NRFKYTVLRASRSGVVTAVRFEVGQVVAEGQPVVSIANDGEPEIVADVPEDHLAVFKTS
FT                   RYKAWLASAPEQTFEVALRELSPQAAAQTRTFRARLKPVTPRPLPLGATATLVVERQVG
FT                   EAPAAVIPASAITQNNGQPAVWVVHPAGSESAATVDLINVSVHGYRNDEVLVSGPPAGE
FT                   LVVTAGVQKMAPGLRVALPEAARNAETKQVAR"
FT                   /protein_id="YP_003165426.1"
FT   sig_peptide     160287..160355
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.474 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_0137"
FT   misc_feature    160437..161354
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="CAP2UW1_0137"
FT   misc_feature    <160791..160883
FT                   /note="Biotinyl_lipoyl_domains are present in
FT                   biotin-dependent carboxylases/decarboxylases, the
FT                   dihydrolipoyl acyltransferase component (E2) of 2-oxo acid
FT                   dehydrogenases, and the H-protein of the glycine cleavage
FT                   system (GCS). These domains transport CO2...; Region:
FT                   Biotinyl_lipoyl_domains; cl11404"
FT                   /db_xref="CDD:187023"
FT                   /locus_tag="CAP2UW1_0137"
FT   gene            161402..164491
FT                   /db_xref="GeneID:8402264"
FT                   /locus_tag="CAP2UW1_0138"
FT   CDS_pept        161402..164491
FT                   /locus_tag="CAP2UW1_0138"
FT                   /gene_family="HOG000260618" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acriflavin resistance protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bph:Bphy_3505 acriflavin resistance protein"
FT                   /db_xref="GI:257091786"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="GeneID:8402264"
FT                   /translation="MKSFNLTEWALNHRAVVLFLILAIAIGGVLGFTKLGQLEDPNFSV
FT                   PSMTVIVIWPGATAQQIQDEVLNRMEKKFEQIDHFDKVKTYARQGYGGMTLSVVGGTSH
FT                   ADQREAWYQARKKFSDVKLELPDGVIGPIFNDEYGDVTGLLYAVKGDGISHAELSDTAE
FT                   DIKRRLLKVPMVKKVDIYGKQAKKVYVEFSHQRLAALGITPLAIAESLRSQNSVLASGS
FT                   IDTHGDRVLVRVSGQFTSLDDIRNVPIAAGGRLIKLGDFTTITRGYEDPPMYTVRHNGQ
FT                   QVLMLGITMTNDGNIVEFGHAIAKAVANVQAELPHGIELERVADQPTVVSESIWEFERS
FT                   LMEALAIVLAVSLISLGWRIGIVVGLSVPLVLGVVALVMLAMGWNLERVSLGSLIIALG
FT                   LLVDDGIIAVEMMVVKMEEGWDRLKAAAYSYSATAMPRLTGALITVAAFMPIGFSRSTT
FT                   GEYAGGIFWIVGTAVLFSWVVSGIITPYLAVNMLPKDFGTHHHGADPYDTPSYRRLRGW
FT                   IDLAIARRWWVIATTVVALAVAVVGSRFVPQQFFPNSSRPELVVELRLKEGASFAATTE
FT                   QVKKMEAVLKKDEDVRFFTAYTGAGQPRFYLSLNPELPNPGYAAFIVMTRDMEARERVR
FT                   SRLMTSVNEEFPEVWVRVTRLELGPPVGFPVQFRVVGPDTQRVRSIAREVEAAVASSPK
FT                   VRDVQLDWNDPVRTLRVDLDQDKARALGLAPADVAFVTQTVMNGATVSQLREHEDLIDI
FT                   VARAVPSERLDVDTLKDVNLYTREGTVVPLSQVARVRYELEEPVLWRRNRDMAITVRAD
FT                   VKDGEQGVSVTQEIRPMLKEIEAQLPFGYRIDVGGAVEESDIANRALMAVFPVMLVTIL
FT                   TILMLQLQSFSRMFMVFLTAPLGLIGVVAALLIFQAPLGFVAILGITALCGMIMRNAVI
FT                   LVDQVQAEMAEGRDPWNAVLEAAVHRTRPVALTAAATVLAMIPLTRSVFWGPMAIAIMG
FT                   GLTVATLLTIFFVPALYAAWFKVERASAANPEMPPAAAPA"
FT                   /protein_id="YP_003165427.1"
FT   sig_peptide     161402..161497
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.811 at
FT                   residue 32"
FT                   /locus_tag="CAP2UW1_0138"
FT   misc_feature    161414..164434
FT                   /note="Cation/multidrug efflux pump [Defense mechanisms];
FT                   Region: AcrB; COG0841"
FT                   /db_xref="CDD:31183"
FT                   /locus_tag="CAP2UW1_0138"
FT   gene            164582..165238
FT                   /db_xref="GeneID:8402265"
FT                   /locus_tag="CAP2UW1_0139"
FT   CDS_pept        164582..165238
FT                   /locus_tag="CAP2UW1_0139"
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: azc:AZC_0320 alcohol dehydrogenase"
FT                   /db_xref="GI:257091787"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="GeneID:8402265"
FT                   /translation="MGNSMKAAVVHELGKPLGLEEVPVPQPNENQVLVRIAATGICHTD
FT                   LHAAKGDCPVKPQTPFIPGHEGVGTVAAVGRAARGVKEGDRVGIPWLHTARGHCPHSRT
FT                   GWETLSGAHGALVTAESPKAFEQAFDRLRSRGTMALVGLPPGKMSPPIFDMVLKRITSR
FT                   GSIFGTRQDLDEALAFAGSGSVSAHFSWNSLESLNDIFARMEDGKIDGRIVANLQ"
FT                   /protein_id="YP_003165428.1"
FT   misc_feature    164594..>164908
FT                   /note="Medium chain reductase/dehydrogenase
FT                   (MDR)/zinc-dependent alcohol dehydrogenase-like family;
FT                   Region: MDR; cl14614"
FT                   /db_xref="CDD:176839"
FT                   /locus_tag="CAP2UW1_0139"
FT   misc_feature    <164912..165223
FT                   /note="Medium chain reductase/dehydrogenase
FT                   (MDR)/zinc-dependent alcohol dehydrogenase-like family;
FT                   Region: MDR; cl14614"
FT                   /db_xref="CDD:176839"
FT                   /locus_tag="CAP2UW1_0139"
FT   gene            165397..167013
FT                   /db_xref="GeneID:8402266"
FT                   /locus_tag="CAP2UW1_0140"
FT   CDS_pept        165397..167013
FT                   /locus_tag="CAP2UW1_0140"
FT                   /gene_family="HOG000006451" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   mar:MAE_34290 transposase"
FT                   /db_xref="GI:257091788"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402266"
FT                   /translation="MYIARIPNRKSRPAILLRESYREGGKVCTRTIANLTNWAPERIVA
FT                   MERLVKGEFDDWSGEMTSGEIFGVLFALKQLADQVGITRVLGSAAESRLNLFLILARIA
FT                   HGGSRLSAVRWAKQHTVADVLALEEFDEDDLYAALDWLASQQERIERELYRAYVKEQGQ
FT                   PPVLVLYDVTSSYFEGECNELGQYGYNRDGKRGKQQIVIGLLTAEDGEPLAVRVFEGNT
FT                   ADPTTVASQITILKEQFGIAEVVMVGDRGMIKAKGKAALSAQGFRYITALTDAQVRTFL
FT                   KEGVLQTDLFDVPLCEVEHDDKRLIVRRNEIVRVREERRREDKLAQLQAKIADRNAFVK
FT                   NSRRASAATGLAALQRWAKRHKLAAFVTLALNERVIVCTIDQEAKAQDALLDGCYLLET
FT                   DVPQGLMDAKAVDARYRDLQKVERNFRTVKTTFLEIRPIFLRKAERTKAHVFVAMLALK
FT                   ITRRFEAALHRTFGSTVDDPATITPDDALVALGRLTYLYSTDRNGQRHTHLPRPDDQQA
FT                   KILDAIGLSFPLKAKAEKRAV"
FT                   /protein_id="YP_003165429.1"
FT   misc_feature    <165892..166797
FT                   /note="Transposase [DNA replication, recombination, and
FT                   repair]; Region: COG5421"
FT                   /db_xref="CDD:34980"
FT                   /locus_tag="CAP2UW1_0140"
FT   gene            167397..168857
FT                   /db_xref="GeneID:8402267"
FT                   /locus_tag="CAP2UW1_0141"
FT   CDS_pept        167397..168857
FT                   /locus_tag="CAP2UW1_0141"
FT                   /gene_family="HOG000012329" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Patatin"
FT                   /transl_table="11"
FT                   /note="PFAM: Patatin; KEGG: sfu:Sfum_1455 patatin"
FT                   /db_xref="GI:257091789"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="GeneID:8402267"
FT                   /translation="MALLVTCGLAGCATRPVNPRIEHFDPATMYTFQRPSENQEDRQHF
FT                   VLLAFSGGGMRAAAFSYGVLETLRDMQITTPSGRKVRALDEVEVITGVSGGSFTALAYG
FT                   LYGDRLFDDYERRFLRRDVQGQLIARVLNPFNWGALVSTGWGRSELAADLYDDVLFNGA
FT                   TYADLKRDGPQIVVSATDLSEGTRIDFNKPTFDMLCTDLGGFRLARAAAASSAVPVVLS
FT                   AITIDNHGGTCDYRPPAWARLLLDNPDPPRPAVRSIKHLNELRVYTDQSRRPYLHLVDG
FT                   GISDNISARGVLDVLSTFASLHALGMPTPVDRLREVFVFVVNSLATPPNDWSLHENPPG
FT                   MVELLIQTAGAPIDRYSYDTVETLKDMQAGWEVLRVVRTDMKPIAEGNPKLDFILRAPD
FT                   INIHVIDVSFAVLKDSAERDYLHRLPTSLVLPSEAVDRLRAAARTAILESPAIRRLMKQ
FT                   DIARMVGSERTSAGAAQMAVAPARAPVD"
FT                   /protein_id="YP_003165430.1"
FT   misc_feature    167538..>167984
FT                   /note="Patatins and Phospholipases; Region:
FT                   Patatin_and_cPLA2; cl11396"
FT                   /db_xref="CDD:176430"
FT                   /locus_tag="CAP2UW1_0141"
FT   gene            complement(168909..170036)
FT                   /db_xref="GeneID:8402268"
FT                   /locus_tag="CAP2UW1_0142"
FT   CDS_pept        complement(168909..170036)
FT                   /locus_tag="CAP2UW1_0142"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0118"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   min:Minf_0718 predicted permease, member of the PurR
FT                   regulon"
FT                   /db_xref="GI:257091790"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="GeneID:8402268"
FT                   /translation="MRNPTDRETPVPPKTMTIKLPTGWFYGALIVILSAWILNSFLQAM
FT                   LAACVTAIASWPLYTRFAARLPRCIGRNSSSLIFTLALTIFVLAPLMFAFGALLSEAHA
FT                   LLSAIAVADKKGIAVPQGLENAPLIGPWLAARWQSQLASPGALLTWTQRTDAAALVPWA
FT                   QSLGQFTVRHAFIIFFTVLLLFFLYQEGESLAAGFRRVLRRCLGEHADGFADLATRAVR
FT                   ASVNSMLVVALFDGLASGVAYAIVGVPHAAVWAAVTGLLALVPFLGYVAVGALALQLAM
FT                   TVTTTPPLLALGLGCFVLFCGDKVVRPVVACNGVRLRFVWVLMGCLGGFEVLGLIGLVI
FT                   GPVVLTLARELWEQRVRDLAVVDVTDSNPQVSQSA"
FT                   /protein_id="YP_003165431.1"
FT   misc_feature    complement(168966..170018)
FT                   /note="Predicted permease, member of the PurR regulon
FT                   [General function prediction only]; Region: yhhT; COG0628"
FT                   /db_xref="CDD:30973"
FT                   /locus_tag="CAP2UW1_0142"
FT   misc_feature    complement(168984..169955)
FT                   /note="Domain of unknown function DUF20; Region: UPF0118;
FT                   cl00465"
FT                   /db_xref="CDD:186015"
FT                   /locus_tag="CAP2UW1_0142"
FT   gene            170446..172335
FT                   /db_xref="GeneID:8402269"
FT                   /locus_tag="CAP2UW1_0143"
FT   CDS_pept        170446..172335
FT                   /locus_tag="CAP2UW1_0143"
FT                   /gene_family="HOG000260912" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Poly-beta-hydroxybutyrate polymerase domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   sil:SPO0112 poly(3-hydroxyalkanoate) polymerase family
FT                   protein"
FT                   /db_xref="GI:257091791"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="GeneID:8402269"
FT                   /translation="MTTPTDDRRAITPSSSNGPSAPSPSQEALEPAAASRQAGALGARP
FT                   GRRIGDRALYESEWLENADRMTNAAIAHATGGISPTSVAMDLFGWMAHLASSPGKQFEL
FT                   GQKAVRKALRLGRYAATCAADPGATPCIEPLAQDHRFEHEAWQRFPYNVIYQAFLLDQQ
FT                   WWHNATTGVRGVSKHNEEAVSFITRQVLDMFSPSNIPFLNPEIVQTTLAEGGANLLRGA
FT                   QNFAEDLRRGIRGEPPAGTETFQVGKNLAVTPGKVVYRNRLMELIQYTPTTASVQREPV
FT                   LMQSAWMMKYYILDLSPHNSLVKYLVDRGHTVFMISWLNPRPEDRDLGLEDYRKLGTMA
FT                   AIDAISNILPDRKIHAVGYCLGGILLTIAAATMARDGDDRLASVTLFTTMTDFTEVGEI
FT                   NVFMDAGEVTMLEDIMWQKGYLDHKQISGGFQLLKSADLIWSKMVREYYLGNREPMFDL
FT                   MAWNADGTRMPYRQHSEVLRRLYVDNELFEGKYMVGGRAISISNIHCPIFAVAAVADHV
FT                   APWHSVYKLHLQSDATELSFVLTSGGHNVGIVNEPGRPRRKFQMATCKEGERCLDAETW
FT                   KAQTPVTQGSWWPAWDQWLTQHSSGGATPPIMGAPDKGYEPLCDAPGTYVHQK"
FT                   /protein_id="YP_003165432.1"
FT   misc_feature    170611..170745
FT                   /note="Poly-beta-hydroxybutyrate polymerase N terminal;
FT                   Region: PHBC_N; pfam12551"
FT                   /db_xref="CDD:152985"
FT                   /locus_tag="CAP2UW1_0143"
FT   misc_feature    170725..172323
FT                   /note="poly(R)-hydroxyalkanoic acid synthase, class I;
FT                   Region: PHA_synth_I; TIGR01838"
FT                   /db_xref="CDD:130897"
FT                   /locus_tag="CAP2UW1_0143"
FT   misc_feature    170854..171360
FT                   /note="Poly-beta-hydroxybutyrate polymerase (PhaC)
FT                   N-terminus; Region: PhaC_N; pfam07167"
FT                   /db_xref="CDD:115798"
FT                   /locus_tag="CAP2UW1_0143"
FT   misc_feature    171376..172023
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="CAP2UW1_0143"
FT   gene            172546..173379
FT                   /db_xref="GeneID:8402270"
FT                   /locus_tag="CAP2UW1_0144"
FT   CDS_pept        172546..173379
FT                   /locus_tag="CAP2UW1_0144"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bid:Bind_0201 enoyl-(acyl carrier protein) reductase"
FT                   /db_xref="GI:257091792"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:8402270"
FT                   /translation="MTQLSATEQFFEDLKKEVKGSAGPLEGKKALIVGIANDQSIAYGC
FT                   ALAFRAFGADIAMTYLNDKTKKYTQPLADHLGVDPALYRPCDVRVEGQLEAVFEAIGKT
FT                   WGKLDIALHSIAFAPREDLHGRVTDCSRDGFLSAMDVSCHSFIRMAKLAEPLMKDGGAL
FT                   FTMSYYGAEKVVEHYNVMGPVKAALEASARYLADELGPKGIRVHPMSPGPIQTRAATGI
FT                   DRFDELMEIAAQRAPSRMLVTIEDVGMATAFLASDFAKLITGDTIHVDGGYHIVG"
FT                   /protein_id="YP_003165433.1"
FT   misc_feature    172606..173376
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0144"
FT   misc_feature    172612..173376
FT                   /note="Enoyl-[acyl-carrier-protein]; Region: FabI; COG0623"
FT                   /db_xref="CDD:30968"
FT                   /locus_tag="CAP2UW1_0144"
FT   gene            173754..174557
FT                   /db_xref="GeneID:8402271"
FT                   /locus_tag="CAP2UW1_0145"
FT   CDS_pept        173754..174557
FT                   /locus_tag="CAP2UW1_0145"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: EAL domain protein; KEGG: bbr:BB3116
FT                   hypothetical protein"
FT                   /db_xref="GI:257091793"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="GeneID:8402271"
FT                   /translation="MNQDLLMVLECATVHYQPIVDLDTGAIAGFEALLRTVDADGDAGS
FT                   IGPVIEQIESDPVLLDRLMRRLLGMISRDAVPLFERYPGFYVSVNVPPAILGARTALGE
FT                   PAMRGMLSDFDLEPYLGRLVCEITERQALSAQGRAALELARQVGIRLAVDDVGTGHSGI
FT                   AQMLGLTIDVLKLDRSQVVLLTTDVTAERLVRGIIVLASMIRARVVAEGVESAAQAFFL
FT                   QAAGVDYGQGWFWSPALPAAELPKVFEAGFPNWRRDLVARLNEAR"
FT                   /protein_id="YP_003165434.1"
FT   misc_feature    173790..174482
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="CAP2UW1_0145"
FT   gene            complement(174541..175980)
FT                   /db_xref="GeneID:8402272"
FT                   /locus_tag="CAP2UW1_0146"
FT   CDS_pept        complement(174541..175980)
FT                   /locus_tag="CAP2UW1_0146"
FT                   /gene_family="HOG000126763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; KEGG: dar:Daro_2258 heavy metal sensor kinase"
FT                   /db_xref="GI:257091794"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="GeneID:8402272"
FT                   /translation="MRLSGMRSMTFRLTMLFALSSTVVLLLLGYLIAGAVERHFEEQDM
FT                   EVLSGKLKLAQHALEKAHSQADLDALPQQLADSLVGHDGLAVIVLAPDGRTLFATRAAE
FT                   FPRTLLESASQADQARPTVWTTGDKRPLRGISALARTGIKGFHPLIVGVATDVSHHEHF
FT                   MKSFRTTLWSFVILAALLTGVLGWLAVRRGLAPLQAIRREAAAITAHRLHSRLPADAIP
FT                   VELAELTATLNEMLARLEDSFRRLTAFSSDIAHELRTPVTNLLTQTQVTLAKERPAGEY
FT                   GDVLASNAEELERLSRMIADMLFLARADNDLVMPRQEPLDLVDEVKGLFAFYEALAEEK
FT                   TITLTCSGSGRVGGDQLMLRRAISNLLSNALRHTPVGGQVSVHVDDTGDTGVRLSVQNS
FT                   GETIALEHLPRLFDRFYRVDSSRQRASDGAGLGLAITRSIMRAHGGDAAIRSARGMTVC
FT                   ELHFPPELATDRHPICINVPR"
FT                   /protein_id="YP_003165435.1"
FT   sig_peptide     complement(175873..175980)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.530 at
FT                   residue 36"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(174592..175962)
FT                   /note="heavy metal sensor kinase; Region: cztS_silS_copS;
FT                   TIGR01386"
FT                   /db_xref="CDD:162333"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(175258..175470)
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(175060..175251)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(order(175075..175077,175087..175089,
FT                   175096..175098,175108..175110,175117..175119,
FT                   175129..175131,175180..175182,175189..175191,
FT                   175201..175203,175210..175212,175222..175224,
FT                   175234..175236))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(175216..175218)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(174619..174906)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(order(174628..174630,174634..174636,
FT                   174682..174693,174772..174777,174781..174783,
FT                   174787..174789,174793..174795,174865..174867,
FT                   174874..174876,174886..174888))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(174874..174876)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0146"
FT   misc_feature    complement(order(174685..174687,174691..174693,
FT                   174775..174777,174781..174783))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0146"
FT   gene            complement(175971..176654)
FT                   /db_xref="GeneID:8402273"
FT                   /locus_tag="CAP2UW1_0147"
FT   CDS_pept        complement(175971..176654)
FT                   /locus_tag="CAP2UW1_0147"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: rfr:Rfer_0422 two component heavy
FT                   metal response transcriptional regulator, winged helix
FT                   family"
FT                   /db_xref="GI:257091795"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="GeneID:8402273"
FT                   /translation="MKILVVEDEPKTGNYLKQGLLEAGFVVDLARDGEDGMHCALTEAY
FT                   DLVILDVMLPGIDGWSVLRGIRKSGKDMPVLFLTARDHVDDRVRGLELGADDYLVKPFA
FT                   FSELLARVRSLLRRGGKATESEFLRAADLELDLMRRRVNRSGKRIDLTAKEFALLELLL
FT                   RRQGEVLPRSLIASQVWDMNFDSDTNVIEVAIRRLRAKMDDGFEPKLIRTVRGMGYVLE
FT                   VTACA"
FT                   /protein_id="YP_003165436.1"
FT   misc_feature    complement(175992..176648)
FT                   /note="heavy metal response regulator; Region:
FT                   cztR_silR_copR; TIGR01387"
FT                   /db_xref="CDD:130454"
FT                   /locus_tag="CAP2UW1_0147"
FT   misc_feature    complement(176307..176645)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0147"
FT   misc_feature    complement(order(176349..176354,176361..176363,
FT                   176418..176420,176478..176480,176502..176504,
FT                   176631..176636))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0147"
FT   misc_feature    complement(176502..176504)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0147"
FT   misc_feature    complement(order(176478..176486,176490..176495))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0147"
FT   misc_feature    complement(176346..176354)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0147"
FT   misc_feature    complement(175992..176273)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="CAP2UW1_0147"
FT   misc_feature    complement(order(176001..176003,176016..176018,
FT                   176049..176054,176076..176078,176085..176087,
FT                   176139..176144,176199..176201))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="CAP2UW1_0147"
FT   gene            176805..178154
FT                   /db_xref="GeneID:8402274"
FT                   /locus_tag="CAP2UW1_0148"
FT   CDS_pept        176805..178154
FT                   /locus_tag="CAP2UW1_0148"
FT                   /gene_family="HOG000220103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dar:Daro_2263 outer membrane efflux protein"
FT                   /db_xref="GI:257091796"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:8402274"
FT                   /translation="MRQPTTASGHDERSQESRRVRPLRVLPCGFLGAQACALGLALAIA
FT                   APAWPQDKAIGRTVESLLVFARETNPEYAAIRSEADAALERVTPAGALADPKFRMELRD
FT                   ITKSGDQNPTLSPSQVGSTRYLLSQDLPWFGKRELKREIAEFEAEGATSRARGTWSDLA
FT                   ARIKAAHAQRYYLSRNEKLTREILELIVRLEKVAQVRYAGGLAAQQDVIRAQVEQTSMR
FT                   SELVTLESESRQVDARLNALLARPAAAELAPPERLPVLPTAARLDYATLEERVRARNPV
FT                   LFAEESRLKAAEKSRELAYRNRYPDFTVGFGPIQYQNAVKEWEVMVELNIPLQLSTRRA
FT                   QERESEAMLSAARSRKEATANQVLADLAENLAGIEAARRIEMLATTSLLPQAELTFRAA
FT                   LAGYENGKVDFATLLEAQRQIRQARQSQIKAQSEAQIRLAAIERLLGEDL"
FT                   /protein_id="YP_003165437.1"
FT   misc_feature    176982..177497
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_0148"
FT   misc_feature    177606..178142
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_0148"
FT   gene            178151..179500
FT                   /db_xref="GeneID:8402275"
FT                   /locus_tag="CAP2UW1_0149"
FT   CDS_pept        178151..179500
FT                   /locus_tag="CAP2UW1_0149"
FT                   /gene_family="HOG000126091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: rfr:Rfer_0412 secretion protein HlyD"
FT                   /db_xref="GI:257091797"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:8402275"
FT                   /translation="MKQATGIAIGLVAVTVLAAGSGYWLGSRGAVPPGEGSATMTAAAA
FT                   KGAGEPEKRKVLYYRNPMGLPDTSPVPKKDSMGMDYTPVYADEQDDEPASANQIRISTE
FT                   KVQKLGVRTEAAQRRTLDRTVRAAGRIEPDERRLFTIAPKFEGYVERLYVNVTGQPVGK
FT                   GQPLFEVYSPELVSAQREYTVAAQGVTALKEAGGQAQTGMQDLANASLQRLRNWDVSPE
FT                   QVKALAESSEAKRTLTFRSPVAGIVTEKKAVQGMRFMPGEALYQVADLSSVWVIADVFE
FT                   QDIGLVRTGARAKIRINAYPDKLFEGAVTYVYPTLKSDTRTVPVRVELANPGLLLKPAM
FT                   FAQVELAVSAKGPMVSVPLSAVIDSGTRQVVLIQQGEGRFAPREVKLGARSDDYVEVVD
FT                   GVKDGEQVVVAANFLIDSESNLKAALAGFAPAASADAGKAGSAANPHAGH"
FT                   /protein_id="YP_003165438.1"
FT   sig_peptide     178151..178207
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.924 at
FT                   residue 19"
FT                   /locus_tag="CAP2UW1_0149"
FT   misc_feature    178301..179407
FT                   /note="copper/silver efflux system membrane fusion protein
FT                   CusB; Provisional; Region: PRK09783"
FT                   /db_xref="CDD:182073"
FT                   /locus_tag="CAP2UW1_0149"
FT   gene            179536..182667
FT                   /db_xref="GeneID:8402276"
FT                   /locus_tag="CAP2UW1_0150"
FT   CDS_pept        179536..182667
FT                   /locus_tag="CAP2UW1_0150"
FT                   /gene_family="HOG000126202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: dar:Daro_2265 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="GI:257091798"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:8402276"
FT                   /translation="MLAKIIDWSGGNRFLVLLATLFVTIGGIYAVLRTPIDALPDLSDV
FT                   QVIVYTEYPGQAPQVVEDQVTYPLSTAMLSVPRSRVVRGFSFFGASFVYIIFEDGTDIY
FT                   WARSRVLEYLSFASSRLPRGVTPSLGPDATGVGWVYQYALLARDKTLAELRTIQDWYVR
FT                   YPLSKAHGVAEVASIGGFVQTYQVTVDPVKLRAYGIPLMKIAQVIRDSNRDVGGRVVEM
FT                   AETEYMVRGKGYLRGKSDIERLVVKSDRGTPVLIRDIARVELAPDERRGLAELNGEGEV
FT                   VSGIAMARYGQNALEVIHNVKAKIAEIGPGLPEGVTVETVYDRSELIHRAIETLKRTLL
FT                   EESFIVALVCIVFLLHVRSALVAILMLPVGILIAFIAMRSLGMNSNLMSLGGIAIAIGA
FT                   MIDAAIVMIENAHKHLERLPAGHSPGDRAEAMLAACREVGPALFFSLLVITVSFLPVFS
FT                   LEGQEGRLFSPLAYTKTFAMAGAALLSITLVPVLMLLFIRGRILPEAKNPVNRFLIWVY
FT                   RPIIAGVMRWKKLTLVLAVLAMALSLYPASRLGSEFMPTLNEGTLLYMPTSLPGMSITK
FT                   AAELMQTQNKIIERFPEVASVYGKAGRANTATDPAPTEMFETVINLKPESEWRAGMTTD
FT                   KLIAELDKALQFPGVANAWTMPIKARIDMLSTGIRTPIGIKVFGKDLDEMETLAKEIEA
FT                   VVKTVPGTTSAFAERITGGFYLNIEPDREQLARYGLAVGELQDVIGSALGGEMVTTTVE
FT                   GRERFGVTIRYPRELRSDPQQIAREVLIPTMNGAMIPLGQLARVVVAKGPPSIRTENAL
FT                   LSAYIYVDIRDRDIGGYVADAKKAVAEQVSFPPGYYVTWSGQFEYMERATEKMKIVIPV
FT                   TLLSIFLLLYLNFKRLTETLIVMLSVPFALVGGIWLLWLLDYNLSVAVVIGFIALAGVA
FT                   AETGVIMLIYLDHAWEAVQAKCRAAGRAPNVDDLYAAIMEGAVERVRPKMMTVVAIMAG
FT                   LLPILWGTGTGSEVMSRIAAPMVGGMISSTVLTLAVIPAIYALVKQWRLRPGSG"
FT                   /protein_id="YP_003165439.1"
FT   misc_feature    179536..182652
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="CAP2UW1_0150"
FT   gene            complement(182674..183585)
FT                   /db_xref="GeneID:8402277"
FT                   /locus_tag="CAP2UW1_0151"
FT   CDS_pept        complement(182674..183585)
FT                   /locus_tag="CAP2UW1_0151"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rde:RD1_1403 hypothetical protein"
FT                   /db_xref="GI:257091799"
FT                   /db_xref="GeneID:8402277"
FT                   /translation="MNSRSWRVPSLTVLASLMAVTGSVQGGEAGERQAFVSLTPVYQGN
FT                   ADLDRSGDFSVGGAILRGGVSQDLGGGRRAGITLTYDYLDYSFSNSGAFDRVAPWNIVQ
FT                   RYGVSAPLSFEVGDGWSVGVAPSVDWFRENGAKSGDSLIWGATVSGSRRFERGNRLGLG
FT                   IGVFDGIEKTSVFPLLVIDWRFGDHWRLTNPLPSGPTGPAGLELGYYFDGGWTAGVGVA
FT                   YRVLRFRLSETGPVRNGIGEESGMPVFVRVTRNFTDQLALHLYGGVVANGRLRVENSSG
FT                   HLVRKEDFDPAPLFGATFIGRF"
FT                   /protein_id="YP_003165440.1"
FT   sig_peptide     complement(183505..183585)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT                   /locus_tag="CAP2UW1_0151"
FT   gene            complement(183582..183857)
FT                   /db_xref="GeneID:8402278"
FT                   /locus_tag="CAP2UW1_0152"
FT   CDS_pept        complement(183582..183857)
FT                   /locus_tag="CAP2UW1_0152"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091800"
FT                   /db_xref="GeneID:8402278"
FT                   /translation="MIDPIVEEARKYRAEHARRFNFDLPAIGADLEEIDATCGHTVVSL
FT                   PPRTLDVTTDQLEPSDQGRQAVDVHSLSPRLSLSFGPPDIYKRKSL"
FT                   /protein_id="YP_003165441.1"
FT   gene            184033..184269
FT                   /db_xref="GeneID:8402279"
FT                   /locus_tag="CAP2UW1_0153"
FT                   /pseudo
FT   gene            complement(184313..185551)
FT                   /db_xref="GeneID:8402280"
FT                   /locus_tag="CAP2UW1_0154"
FT   CDS_pept        complement(184313..185551)
FT                   /locus_tag="CAP2UW1_0154"
FT                   /gene_family="HOG000036732" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine dehydratase alpha chain"
FT                   /transl_table="11"
FT                   /note="PFAM: serine dehydratase alpha chain; serine
FT                   dehydratase beta chain; KEGG: bfs:BF1216 putative L-serine
FT                   dehydratase"
FT                   /db_xref="GI:257091801"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="GeneID:8402280"
FT                   /translation="MKSLRELYRIGLGPSSSHTMGPRFAAQAFKAANPTAARLRVTLYG
FT                   TLAATGRGHLTDRAVSVPFAPTPVDIVWLPDRLLPRHPNGMQFEALDAGGGVLAARVVY
FT                   SVGGGALLDENGQPDGGDDVYPYAGMREILEEAEREGLRIWELVDRHEGPPIWPYLSGV
FT                   WSSMRRAIASGLNAEGRLPGTLNVPRKASAYHARAQSLAGYFGQTALQFAYALAVSEEN
FT                   AAGGEVVTAPTCGACGVLPAVLFFLQQQAQLSDEKIHRALATAGLIGNLVKRNASISGA
FT                   EVGCQGEVGTACAMAAGAAAQLLGGSVRQIEYAAEMGLEHHLGLTCDPIGGYVQIPCIE
FT                   RNAIAAVRAVDCAAYALLSDGHHIVSFDEVVRTMWETGCDMKASYRETARGGLAKIHAL
FT                   RKKGAGSVPGMGS"
FT                   /protein_id="YP_003165442.1"
FT   misc_feature    complement(184367..185551)
FT                   /note="L-serine dehydratase, iron-sulfur-dependent, single
FT                   chain form; Region: sda_mono; TIGR00720"
FT                   /db_xref="CDD:129803"
FT                   /locus_tag="CAP2UW1_0154"
FT   misc_feature    complement(185207..185524)
FT                   /note="Serine dehydratase beta chain; Region: SDH_beta;
FT                   pfam03315"
FT                   /db_xref="CDD:146115"
FT                   /locus_tag="CAP2UW1_0154"
FT   misc_feature    complement(184367..185140)
FT                   /note="Serine dehydratase alpha chain; Region: SDH_alpha;
FT                   cl12120"
FT                   /db_xref="CDD:159780"
FT                   /locus_tag="CAP2UW1_0154"
FT   gene            185682..185810
FT                   /db_xref="GeneID:8402281"
FT                   /locus_tag="CAP2UW1_0155"
FT   CDS_pept        185682..185810
FT                   /locus_tag="CAP2UW1_0155"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091802"
FT                   /db_xref="GeneID:8402281"
FT                   /translation="MLSPGHAVFSNTSVIAGPVTLECQSESGNGLNWLQIAACGRG"
FT                   /protein_id="YP_003165443.1"
FT   gene            complement(185829..186446)
FT                   /db_xref="GeneID:8402282"
FT                   /locus_tag="CAP2UW1_0156"
FT   CDS_pept        complement(185829..186446)
FT                   /locus_tag="CAP2UW1_0156"
FT                   /gene_family="HOG000125745" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   oan:Oant_1991 glutathione S-transferase domain protein"
FT                   /db_xref="GI:257091803"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="GeneID:8402282"
FT                   /translation="MSDLVFYTHPQSRGRIVRWMLEECEAPYQTEIVQYGLQMKTPPYT
FT                   DINPMGKVPAIVHQGRVVTECAAIIAYLADVFAAAALAPPAAQRQDYYRWLFFAAGPFE
FT                   QATTNNALGFVVSEEKQRMVGYGNLDLVVNTLARAVSAHPYIAGDHFSAADVYVGSQIG
FT                   YGLQFGTLPDRAEFRDYFARLENRPARLRATQMDDALINKPV"
FT                   /protein_id="YP_003165444.1"
FT   misc_feature    complement(185847..186437)
FT                   /note="Glutathione S-transferase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: Gst;
FT                   COG0625"
FT                   /db_xref="CDD:30970"
FT                   /locus_tag="CAP2UW1_0156"
FT   misc_feature    complement(186249..186437)
FT                   /note="GST_N family, Saccharomyces cerevisiae GTT1-like
FT                   subfamily; composed of predominantly uncharacterized
FT                   proteins with similarity to the S. cerevisiae GST protein,
FT                   GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are
FT                   cytosolic dimeric proteins...; Region: GST_N_GTT1_like;
FT                   cd03046"
FT                   /db_xref="CDD:48595"
FT                   /locus_tag="CAP2UW1_0156"
FT   misc_feature    complement(order(186249..186254,186285..186293,
FT                   186408..186410))
FT                   /note="putative GSH binding site (G-site); other site"
FT                   /db_xref="CDD:48595"
FT                   /locus_tag="CAP2UW1_0156"
FT   misc_feature    complement(order(186378..186383,186390..186395,
FT                   186399..186404,186408..186410))
FT                   /note="putative C-terminal domain interface; other site"
FT                   /db_xref="CDD:48595"
FT                   /locus_tag="CAP2UW1_0156"
FT   misc_feature    complement(order(186252..186257,186291..186293))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:48595"
FT                   /locus_tag="CAP2UW1_0156"
FT   misc_feature    complement(185856..186173)
FT                   /note="GST_C family, unknown subfamily 8; composed of
FT                   uncharacterized bacterial proteins with similarity to GSTs.
FT                   GSTs are cytosolic dimeric proteins involved in cellular
FT                   detoxification by catalyzing the conjugation of glutathione
FT                   (GSH) with a wide range of...; Region: GST_C_8; cd03207"
FT                   /db_xref="CDD:48134"
FT                   /locus_tag="CAP2UW1_0156"
FT   misc_feature    complement(order(185955..185957,185967..185969,
FT                   185976..185981,185988..185990,186147..186149,
FT                   186168..186170))
FT                   /note="putative N-terminal domain interface; other site"
FT                   /db_xref="CDD:48134"
FT                   /locus_tag="CAP2UW1_0156"
FT   misc_feature    complement(order(186042..186044,186156..186158,
FT                   186165..186170))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:48134"
FT                   /locus_tag="CAP2UW1_0156"
FT   misc_feature    complement(order(185955..185957,185964..185966,
FT                   186120..186125,186132..186137,186147..186149))
FT                   /note="putative substrate binding pocket (H-site); other
FT                   site"
FT                   /db_xref="CDD:48134"
FT                   /locus_tag="CAP2UW1_0156"
FT   gene            complement(186629..190363)
FT                   /db_xref="GeneID:8402283"
FT                   /locus_tag="CAP2UW1_0157"
FT   CDS_pept        complement(186629..190363)
FT                   /locus_tag="CAP2UW1_0157"
FT                   /gene_family="HOG000158245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: amr:AM1_5108 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="GI:257091804"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:8402283"
FT                   /translation="MASARPLRLWLALRIALAGMVPLAMVAVLIVGVLLPQRRADLDTG
FT                   YQGLAGALAAQVETHLLGAERQLRAIAEDFRSHPGDHSAPNWSRTLDAHAGTGDGFAAI
FT                   YLADPDGSAYAVGLPRAERGRRRDLVHLDLSERAALREARQQNEEVWSAAFLSTVTGRL
FT                   AVSVAIPLSEQVLVGQIALDRLALLLGRSPAESAMHTIILDAQGQIIAHSAGVQSGAPF
FT                   SVDHLPGIRDALLGHRTTQDFAVDGEMFVGTSVSIPRFGWILLVAQPHSDTLRPFLSTA
FT                   WVLAAGALAALLLTVVMALTMARSLARPIGRYAEQAHAIAGGDYSQPWPVYRIREFDRL
FT                   AGDLERMALAIRQREQELAKSEARYRSVIASAPLAIFQFDERGVFALSEGKGLARVGLV
FT                   AGEAVGQSLFELYRGYPELCDYARRAIGGEPLHFVSRFGDTWFDTCFSPVRDAAGCLQV
FT                   MGVAVDISERLHAEKALRESEARLRTAIESIPFDLFLIGPDGRYVLQNTACRKAWGDVL
FT                   GKYPGDVTDDTAILARWDDNNKRALAGEIVEEDVRLTVGNEERYLHNIIAPIKDGDDIR
FT                   GILGINIDITERKRSAELLELMRLSVEYGSDAIFWMNRDGSIAYVNEQACRSLGYVRAD
FT                   LLQLRLWEVDPNYSTDTWDEAWRALTETGSFHAETRHRRHDGSEFPVEVNAIAITYEGR
FT                   TYAIGFACDITERKRDHEILKRSETDLQLAVEVAGLGHWKWDIRTGELIWSERCKALYG
FT                   LPPDTELTYERFLARVHPDDRARVDALLREALEKRGGYELEKRLVWPDGSVRWTSSMGR
FT                   VICDSDDQPVLMVGVTLDITERKQAEDALRLTQFTVDRTADAVFLIDAESRFKYVNEAA
FT                   CVALDYTREELTSMSIPDIDPDVSDQMASDIFQDLKRQGSLRFETRHRRKDGTTFPVEV
FT                   NANYIAFSGEELNSCFVRNITERKRAEDELERHQEHLEELVTERTAELRQAMEQLVQAE
FT                   KLAALGHLVAGMAHELNTPLGNARVVASSLGAEVRNFAAAVDAGALRRSQVATFLERSR
FT                   EAVELLERNAARAADLISNFKQVAVDQASARRRRFDLRQTVEELLVTLQPQLKRTAHRI
FT                   ELDIPRELELDSYPGPLEQVLANLVGNSLTHGFAGIEAGLIRVRAAPLDGDRVQIDYTD
FT                   DGVGIPDGLLHRIFEPFFTTRLGQGGSGLGLYIVYNLVTGVLGGTIRGFSDVGKGVAFV
FT                   LILPRIASERTLQTDTHEQ"
FT                   /protein_id="YP_003165445.1"
FT   sig_peptide     complement(190283..190363)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.834 at
FT                   residue 27"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(189296..189454)
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(188939..189283)
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(<187838..189070)
FT                   /note="hypothetical protein; Provisional; Region: PRK13560"
FT                   /db_xref="CDD:106506"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(188252..188548)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(188333..188335,188348..188350,
FT                   188423..188434,188471..188473,188489..188491,
FT                   188501..188503))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(188306..188308,188312..188314,
FT                   188393..188398,188405..188407,188429..188431,
FT                   188441..188443))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(187871..188173)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(187958..187960,187973..187975,
FT                   188051..188062,188102..188104,188120..188122,
FT                   188132..188134))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(187931..187933,187937..187939,
FT                   188021..188026,188033..188035,188057..188059,
FT                   188069..188071))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(187496..187852)
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(187514..187813)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(187595..187597,187610..187612,
FT                   187688..187696,187733..187735,187751..187753,
FT                   187763..187765))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(187568..187570,187574..187576,
FT                   187658..187663,187670..187672,187694..187696,
FT                   187703..187705))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(187148..187393)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(187160..187162,187172..187174,
FT                   187181..187183,187193..187195,187202..187204,
FT                   187214..187216,187319..187321,187328..187330,
FT                   187340..187342,187349..187351,187361..187363,
FT                   187373..187375))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(187355..187357)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(186680..186994)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(186692..186694,186698..186703,
FT                   186716..186718,186722..186724,186773..186784,
FT                   186851..186856,186860..186862,186866..186868,
FT                   186872..186874,186953..186955,186962..186964,
FT                   186974..186976))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(186962..186964)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0157"
FT   misc_feature    complement(order(186776..186778,186782..186784,
FT                   186854..186856,186860..186862))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0157"
FT   gene            complement(190793..193801)
FT                   /db_xref="GeneID:8402284"
FT                   /locus_tag="CAP2UW1_0158"
FT   CDS_pept        complement(190793..193801)
FT                   /locus_tag="CAP2UW1_0158"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; GntR domain protein; PAS fold-4 domain protein;
FT                   PAS fold domain protein; KEGG: dvl:Dvul_1149 PAS/PAC sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="GI:257091805"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:8402284"
FT                   /translation="MIRGSWRQQSRKGGSATALTCSLALVAVRGKRLARLLLAVACLTL
FT                   PVASIADERPGHAHVDILVLHSYHQGLPWTDSEQDGLRVGLAEHLPRLGLFIEYLDALR
FT                   FPLRGPDAEAAAAQRLAERYASMHIEYLVATDDPAYRLLLAHRDRLWPGIPILFAGVNN
FT                   IDSRDIAHLDRVAGVAERPDFFANLALIQSLHPKVDRLVVVGDETRTFASNRKALEDAN
FT                   ATLARPFTVEVIVRHSLRDVLAELRSLSGDFVIFLMGRPFDDEDRIGAEAVVAEAVRGA
FT                   TRHAVYSAWSFFLGHGIVGGKLVSGKEQGLALAGLLTDLYAGKALADLPRVIDSPNRYL
FT                   FDYTELDRLGLSGHSLPPGSVVINRPASIWDSYPKTFAASLAVFVFLLALLALQRRNLR
FT                   VKQALSAEIEKELVLVQALMNAAPFPMFFKDVALRYQRINDAFVAFLGKSREEIIGQTA
FT                   SAVAPPAQVSVYRSRDEDLLAEGGRQIYETVVVGPQQAPRDVVFHKAVVRLPDGRVEGI
FT                   VGAMLDVSELRRSERELRELNEHLEQRVAGRTADLAQSNVRLQQAVDSLALAQDELVRS
FT                   EKLASLGSMVAGVAHELNTPIGNALTVSTAMQNKRNALAAELTQGVLRKSSLDQYLSHG
FT                   ESGFAMLVRNLERAARLITNFKEVAVDQTSDRRRRFRLLDTVEECVHTFTAGVGARVPG
FT                   FQVDVAESIAFDAYPGALGQILLNLFENARVHAFADGAPGTIRIGAQALPDGNVQISVG
FT                   DNGKGIAADALPKIFDPFFTTRLGQGGSGLGLAIVYRLVTKKLGGKIRISSEPGQGAIF
FT                   IIELPATAPEVDSGDEVTATHAAWAPPAGMNPAGTGAGDASPLHLRDELLDIRELVESR
FT                   AAAATTRRITDAGRRRLADVFERLDKSFSTEDAEAQVACDLAFHMAIIDLSVDPALQKV
FT                   GAAVIPLMYGHMRRTLTRLMPDPERRDTLRRQHRAIYEAIIAGDPDSASAAAAAHMAYV
FT                   RTQADRREETAAS"
FT                   /protein_id="YP_003165446.1"
FT   sig_peptide     complement(193718..193801)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.407 at
FT                   residue 28"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(192227..192544)
FT                   /note="PAS fold; Region: PAS_4; pfam08448"
FT                   /db_xref="CDD:117025"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(192230..192538)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(order(192317..192319,192332..192334,
FT                   192410..192421,192458..192460,192476..192478,
FT                   192488..192490))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(order(192290..192292,192296..192298,
FT                   192380..192385,192392..192394,192416..192418,
FT                   192428..192430))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(191330..>192097)
FT                   /note="sensory histidine kinase AtoS; Provisional; Region:
FT                   PRK11360"
FT                   /db_xref="CDD:183098"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(191354..191668)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(order(191366..191368,191372..191377,
FT                   191390..191392,191396..191398,191447..191458,
FT                   191525..191530,191534..191536,191540..191542,
FT                   191546..191548,191627..191629,191636..191638,
FT                   191648..191650))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(191636..191638)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(order(191450..191452,191456..191458,
FT                   191528..191530,191534..191536))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0158"
FT   misc_feature    complement(190898..191224)
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="CAP2UW1_0158"
FT   gene            194205..195233
FT                   /db_xref="GeneID:8402285"
FT                   /locus_tag="CAP2UW1_0159"
FT   CDS_pept        194205..195233
FT                   /locus_tag="CAP2UW1_0159"
FT                   /gene_family="HOG000004700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: vpa:VPA0790 putative YhfP protein"
FT                   /db_xref="GI:257091806"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="GeneID:8402285"
FT                   /translation="MDPLTHALLGATAAQAALGPRLGRQAWMLGALGGVLPDADILIRS
FT                   ASDPLLAIEYHRHFTHALAFIPCGGALAASPWLLQKRYRPDWRPLLAASTLGYATHGLL
FT                   DACTNYGTHLLWPFSPQRVAWHWITTIGPLLTLILLLGLLFSAGRRSRLPAVLSLLLAV
FT                   AYVGGAAWQRERALDVQAEIAAARGHQVARAEMFPTVGNPILWRSVYQSGTTLYTNRLR
FT                   ILGEDNSLWKQGSRLKLFREDDLSAQALADPRIRRDFARFSYFSAGWTALADDDASVVG
FT                   DARYSLRRDGFEPIWGVRFHPGSVAATEWVDYTARNRIPISELWSEISATAAGYRSVRE
FT                   LP"
FT                   /protein_id="YP_003165447.1"
FT   misc_feature    194298..194555
FT                   /note="Predicted membrane-bound metal-dependent hydrolase
FT                   (DUF457); Region: DUF457; cl00868"
FT                   /db_xref="CDD:186230"
FT                   /locus_tag="CAP2UW1_0159"
FT   gene            195461..196687
FT                   /db_xref="GeneID:8402286"
FT                   /locus_tag="CAP2UW1_0160"
FT   CDS_pept        195461..196687
FT                   /locus_tag="CAP2UW1_0160"
FT                   /gene_family="HOG000219673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   mms:mma_3050 outer membrane cation efflux system protein"
FT                   /db_xref="GI:257091807"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:8402286"
FT                   /translation="MHCNPQRTLKARLAVKLLSVLLGVTTASAQAETLREVFEKAWASS
FT                   PHGRTAEAKRDEVAASRTVAESWFPAAPKVDAFHRTDRWNSDLGNQESEIGVSVPLWLP
FT                   GQKAARRSLAEAEGGENEGDIQATRLAVAGELRRALWTLIMARSEAEVAAERLKAALAL
FT                   EEDVGRRLKVGEIARSDLLLARQETASARAAAADAQLGVVRSLQRYRVLTGSERLPDDP
FT                   QEPVAVADNRPVDPRVAAGQAVIERARAALKLAQESRREAPSVGVLYRRDRDVSGATPR
FT                   DSIGFAISIPLAVEVRNAPLLASANTALIDAEARYRRLLAEVEAEVREAEAQLDSAGLG
FT                   ATLAVEREHAAAERLALMRRSFELGETSLVELLRAHSQTTEARIEGARSRSRLSAAQAN
FT                   LNQARGITP"
FT                   /protein_id="YP_003165448.1"
FT   sig_peptide     195461..195556
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 32"
FT                   /locus_tag="CAP2UW1_0160"
FT   misc_feature    195548..>196336
FT                   /note="type I secretion outer membrane protein, TolC
FT                   family; Region: type_I_sec_TolC; TIGR01844"
FT                   /db_xref="CDD:162556"
FT                   /locus_tag="CAP2UW1_0160"
FT   gene            196684..197256
FT                   /db_xref="GeneID:8402287"
FT                   /locus_tag="CAP2UW1_0161"
FT   CDS_pept        196684..197256
FT                   /locus_tag="CAP2UW1_0161"
FT                   /gene_family="HOG000158242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mrd:Mrad2831_2533 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="GI:257091808"
FT                   /db_xref="GeneID:8402287"
FT                   /translation="MTRPFFLPTWAAACVAASLLALFSLSAPLIAHEGHDHGAAAKPTD
FT                   VRLAPRFEVRNEDVEVVGVLADKTLLIYLDRVSDNRPVQDAQIEVEGPGIKGVASAMPD
FT                   GVYQLPAAALAPAGRYPLTLTIQAGESVDLLAATLEVGEVPAAASAEENTKRPWWLLAG
FT                   ISLLVLSGGLVAHRLRRQARERAIHHV"
FT                   /protein_id="YP_003165449.1"
FT   sig_peptide     196684..196779
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 32"
FT                   /locus_tag="CAP2UW1_0161"
FT   gene            197249..198451
FT                   /db_xref="GeneID:8402288"
FT                   /locus_tag="CAP2UW1_0162"
FT   CDS_pept        197249..198451
FT                   /locus_tag="CAP2UW1_0162"
FT                   /gene_family="HOG000219675" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: tbd:Tbd_1747 hypothetical protein"
FT                   /db_xref="GI:257091809"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:8402288"
FT                   /translation="MSDYRTSGRHAVVLLLAGVLTVQQVWAHGGEKHDDEKKSTAAPVA
FT                   VAAVSAVKAVKAVNAQGQVTFVEPALRLPDGSVFVPKSAQRQLALRTLAARKGEFPRTI
FT                   ELNGRVVGDPNAGGRVQTFQSGRIEAGPQGLAVLGQRVGKGQVLAWLQPASSAIERGSQ
FT                   QAALAELAAQESILERRVARFRQLEGSVPQKDVEQAQIELAAFKKRKGALGGSLGREAL
FT                   VAPVSGVVSAANAVVGQVVNAREVVFEVIDPQRLAVEALAYDPLLLAGLAGASAPVAGG
FT                   VIDLAFVGIGRTLKEQAMPVLFRVELPKTGELPALAVGQTLKVLAQTRERQSGVAVPVG
FT                   AVVRNAANESVVWLHTSAERFVSRKVRIAPLDGHSVAVTEGLSGGERVVVQGAASLSQI
FT                   R"
FT                   /protein_id="YP_003165450.1"
FT   sig_peptide     197249..197332
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.988 at
FT                   residue 28"
FT                   /locus_tag="CAP2UW1_0162"
FT   misc_feature    <198137..198439
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="CAP2UW1_0162"
FT   gene            198461..201565
FT                   /db_xref="GeneID:8402289"
FT                   /locus_tag="CAP2UW1_0163"
FT   CDS_pept        198461..201565
FT                   /locus_tag="CAP2UW1_0163"
FT                   /gene_family="HOG000126204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: tbd:Tbd_1746 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="GI:257091810"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:8402289"
FT                   /translation="MFDFIINASLRQRLIVLGVSLLLIIYGALTVRKMPVDVFPDLNKP
FT                   MVTLMTEAGGMAPEEVEQLITFPIESAMNGMPGVTRVRSVSGIGLSVVYIEFAWGSEIY
FT                   RNRQQIAERLNLVREQLPQGIVPQMGPISSIMGEILLIALPADPDKVSPMQVREYADWV
FT                   IRPRLLTIPGVAQVIAIGGQVKQYRVEPDPARLQALAVTLSELEAALKNFGGNTAGGFV
FT                   DAGGREYLIRNIGRSSRLEDLQNQPVALRKGQVILLHQVASVSFAPAIKRGDGSFQGKP
FT                   AVILSVQKQPTADSVALTRAIEKALTEMGRSLPQGVETPQFLFRQANFIEASVNNVEEA
FT                   LRDGAIMVAIILFLFLANFRTTFISLTAIPVSLLITALVFHYFGLSINTMTLGGLAIAI
FT                   GELVDDAVVDVENVLRRLRENRSLPNPRSALEVIAAASKEVRSGVVYATLIVVLVFIPL
FT                   FALPGIEGRLFTPLGVAYIVSILASMAVAMTITPVLCYYLLPKMKHIDHGDSALVKKLK
FT                   AWDERLLNWSFDRGRLLLAGAAITVAVALASIPFFPKSFLPPFNEGTLTVSVLLNPGTS
FT                   LSEANRLGTQAEKLLLTVPEVTEVGRRTGRAELDEHAEGVHSSEIEVDLKASERGREVI
FT                   IADIRQRLSGLPAVVSVGQPISHRLDHLLSGVRAQIALKIFGDDLDTLRGLAGDLRERL
FT                   ARIPGITDLQIEKQVLIPQYKIRVDYDAAARYGVTSGELLQRLEQLLAGERLGQVLEGN
FT                   RRFDLSLRLPEDARGERGLENLLIETPIGRVPLSSLATIEDGDGPNQIGRENTRRRIVI
FT                   SANSDGSDMSRIIAEIRAEIDRQPMPEGYFPLLEGQFQAQEEAARLIAVLALVSLAMIY
FT                   LVLYSRYRSAVLTAIVMGNVPLALVGSVVALWISGEPLSVAALVGFVTLTGIATRNGIL
FT                   KISHYINLCAFEDEVFGRKMIVRGSLERLTPVLMTALVAAFALTPLLLAADAPGKEILH
FT                   PVAVVIFGGLISSTLLDTLLTPVMFWLFGEKPLQRLLAEKAKASF"
FT                   /protein_id="YP_003165451.1"
FT   misc_feature    198461..201520
FT                   /note="Putative silver efflux pump [Inorganic ion transport
FT                   and metabolism]; Region: COG3696"
FT                   /db_xref="CDD:33492"
FT                   /locus_tag="CAP2UW1_0163"
FT   misc_feature    199442..199909
FT                   /note="Protein export membrane protein; Region: SecD_SecF;
FT                   cl14618"
FT                   /db_xref="CDD:176628"
FT                   /locus_tag="CAP2UW1_0163"
FT   gene            201589..202050
FT                   /db_xref="GeneID:8402290"
FT                   /locus_tag="CAP2UW1_0164"
FT   CDS_pept        201589..202050
FT                   /locus_tag="CAP2UW1_0164"
FT                   /gene_family="HOG000229131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tbd:Tbd_1745 hypothetical protein"
FT                   /db_xref="GI:257091811"
FT                   /db_xref="GeneID:8402290"
FT                   /translation="MQRTLIFPLTLVAALVSVGNGAFAHDDATLDKLAGPNGGQLRMAG
FT                   AYHFELVVARDSRQARDNPVSVYLSDHDGKKVAAAGASGTATILAEKAKITVPLVPAGD
FT                   NRLTGIGKYASDPQMKVVVSITLADRKTEQARFTPLTMAAADGHGDHRQ"
FT                   /protein_id="YP_003165452.1"
FT   sig_peptide     201589..201663
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT                   /locus_tag="CAP2UW1_0164"
FT   gene            complement(202107..203561)
FT                   /db_xref="GeneID:8402291"
FT                   /locus_tag="CAP2UW1_0165"
FT   CDS_pept        complement(202107..203561)
FT                   /locus_tag="CAP2UW1_0165"
FT                   /gene_family="HOG000111956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: gur:Gura_2663 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="GI:257091812"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="GeneID:8402291"
FT                   /translation="MRRLLVLAATAILLAGCLLGPDYRRPQVAAPEAFQYAPKDAADTA
FT                   DTLWWKQFQDPVLDQLIAEGLAHNSNIAIAAANVEQAAAVLTQTRSQLFPQLGYGASGE
FT                   RQRSLEPAFAALLRDYPNPSTAYQAGLSASWEIDLWGRIRRQSEAALANLLATDEARRG
FT                   VVLSLVASVANSYLQLRGLDAQLAVAKKTLSAYGESVKLFELQYKYGQVSKMNVVQAQS
FT                   QYESAAAQIPLIESQIAQTQNSLAVLIGRDPGPIARGKSVDDLVLPQVPAGVPSALLER
FT                   RPDLLQAEQTLIAANAQIGAAKALYFPSISLTGAFGGASSDLSNLFKGSSRVWNYTGSI
FT                   VGPIFTFGAVSGQVAQAEAGQAAALLNYQLSIRNAFADVDNALVANQKLQEQLAAQKRL
FT                   VVALSEYSRLARLQYEGGYTGYSTVLQAEQTLFPAELNLASIRASLFASSVNIYKAMGG
FT                   GWVSEADQLTAGGGRPVAPGSIPPLF"
FT                   /protein_id="YP_003165453.1"
FT   sig_peptide     complement(203472..203561)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.514 at
FT                   residue 30"
FT                   /locus_tag="CAP2UW1_0165"
FT   misc_feature    complement(202185..203516)
FT                   /note="NodT family; Region: outer_NodT; TIGR01845"
FT                   /db_xref="CDD:162557"
FT                   /locus_tag="CAP2UW1_0165"
FT   misc_feature    complement(202812..203390)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_0165"
FT   misc_feature    complement(202191..202736)
FT                   /note="Outer membrane efflux protein; Region: OEP;
FT                   pfam02321"
FT                   /db_xref="CDD:145461"
FT                   /locus_tag="CAP2UW1_0165"
FT   gene            complement(203558..206728)
FT                   /db_xref="GeneID:8402292"
FT                   /locus_tag="CAP2UW1_0166"
FT   CDS_pept        complement(203558..206728)
FT                   /locus_tag="CAP2UW1_0166"
FT                   /gene_family="HOG000158129" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   sfu:Sfum_1076 transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /db_xref="GI:257091813"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="GeneID:8402292"
FT                   /translation="MFSRFFIERPIFAAVVAIILSIAGLVSIFVMPVQQYPAITPVQVT
FT                   VQATYPGADSKTLADSVAAPIEAQINGVDKMLYMTSSSSATGQLLLTVYFALDADPDIA
FT                   QVQVQNRVNLALPQLPSAVTQQGVSVQKKSSTIMMLLGVTGKGGRYSPGYVANYANVYV
FT                   LDALKRVPGAGQAQIMGVADQAMRIWMNPDRMASLAITTSDIANAINTQNALFGAGQIG
FT                   QQPTADAVELSFPVVTQSPFTDPRQYEKIILRANQDGSAIVRVGDVARAEVGLRQYVVN
FT                   TRINGEPTTLIAIYQQPGANGLVVSQAVRAALTEMKSRFPEGLDVVVALDTNDFVRLSI
FT                   EEVLKTLAAAMVLVVLIVYLFLQNLRTTLICAVAIVVALVGTFAGMLALGFSINLLTLF
FT                   GLILAIGMVVDDAIVVVENVERNMAQHHLAAKEATIRSLGEIGSSLVAVVLVMASVFVP
FT                   AAFLAGTTGQLYRQFAITIVISVSISGFVALTLTPAMCALLLKHSPAPQRGFFAWFNRQ
FT                   VDRVTRAFGHAVEWVIKRMLLAFVLLGVFLYSIWHLFHLLPTSFVPNEDQGYAMVAIIM
FT                   PQSASLDRTQAVADRVDAILAQIPGVDRRSMITGYSLIDAGYKANAATFFVTFKDFATR
FT                   YGSLDSARSQNARAILLAFYDQAKHIEEAIVLPIAPPAIPGIGTTGGFEFWIQDTAAGD
FT                   PLKLDALTRAFLDKARTRPELASLNSTFNAQAQQLRADVDRDKATLLGLQVQDVYSAIQ
FT                   AQFGSLTASQFSQFSRVWWVIVQSDASFRQQPADLTRLYTRNNQGKMVPLSAVVTTHWT
FT                   VGPDILPHFNGFPAAKVIGNPAPGFSSGQAIAAMEEVAGEILPAGYTFAWSGLAFEEKK
FT                   SRGTSALAFVFGLLIVFLVLAAQYESWTLPGAVMTAVPFGILGALLTNWARGLENDVYF
FT                   QIGLLVLIGLGAKNAVLRVSAAVDFRKQGKSIMEATVLAGEQRLRPIIMTSLAFAFGCL
FT                   PLALALGAGANARHSIGTGIIGGMIGETTLAMLYVPLFFYLFDRLAERRKGGGAPAAAA
FT                   APPTGQRE"
FT                   /protein_id="YP_003165454.1"
FT   sig_peptide     complement(206621..206728)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.703 at
FT                   residue 36"
FT                   /locus_tag="CAP2UW1_0166"
FT   misc_feature    complement(203615..206725)
FT                   /note="The (Largely Gram-negative Bacterial)
FT                   Hydrophobe/Amphiphile Efflux-1 (HAE1) Family; Region:
FT                   2A0602; TIGR00915"
FT                   /db_xref="CDD:162104"
FT                   /locus_tag="CAP2UW1_0166"
FT   gene            complement(206738..207868)
FT                   /db_xref="GeneID:8402293"
FT                   /locus_tag="CAP2UW1_0167"
FT   CDS_pept        complement(206738..207868)
FT                   /locus_tag="CAP2UW1_0167"
FT                   /gene_family="HOG000158247" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   gur:Gura_2665 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="GI:257091814"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:8402293"
FT                   /translation="MHSATLVLGLAALAACGREPAKPAPPPLEVTTLTIEVRDVPVSAE
FT                   YVAQTQSSQAVNIQARVSGFLDKRVYTEGAVVKAGQLLFQIDPKPFQVQVDGAAAALQR
FT                   NQASLQVATANLKRTKPLVEQDALSQKDLDDAQGQYEQAGAAVAQSKAQLESAKLDLSY
FT                   TRITSPVAGVTSFAAVAEGTYVSSQNSQLTTVSVLTPMWVNFSISENEVERIRNNIRKG
FT                   LLKLPADNKLVVEIELGGGNLFPHTGKITFTDPSYNSQTGTFLIRATVDNPDGLLRPNQ
FT                   YVRARLQGALRPNAILIPQRAVQQGAQGHFVWLVNKEGKAEQRPIVVGDWYREHWFVSE
FT                   GLQAGDQLVVDGGMRLSSGATVTVKPPAPRPAAAGS"
FT                   /protein_id="YP_003165455.1"
FT   sig_peptide     complement(207815..207868)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.796 at
FT                   residue 18"
FT                   /locus_tag="CAP2UW1_0167"
FT   misc_feature    complement(206777..207781)
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="CAP2UW1_0167"
FT   gene            208045..209055
FT                   /db_xref="GeneID:8402294"
FT                   /locus_tag="CAP2UW1_0168"
FT   CDS_pept        208045..209055
FT                   /locus_tag="CAP2UW1_0168"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="portal protein"
FT                   /transl_table="11"
FT                   /note="PFAM: portal protein; KEGG: bph:Bphy_7142 phage
FT                   portal protein, HK97 family"
FT                   /db_xref="GI:257091815"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="GeneID:8402294"
FT                   /translation="MGFLSFLNRLRASSSDRSEWGDFWFELVSVRTSSGMRVSADNALR
FT                   LAAVYASVRILAETMASLPFVFYRQRADGGKDRVTDHWLYRLFAKRPNRYQNPYEWREM
FT                   LQGHLALRGNAYNRIVANGRREIVKLVPIHPDRIRMELTPSGDYRYRVTDRDAQFLELR
FT                   KFRITDIARLFRVPPHIIADLDRATFSNIEQQSLEFEMHTMTSWAERWEASLEAELLFD
FT                   GDDLAVEFGLANLMRSDAAGRSSYYQSRIQDGRLAGRWSHQSLPTARCAKRAGRRPPRS
FT                   PAVGSPSCPCMASSLSVATWSTTCRGRAASARSSLRLCWASRWRMTRSSDPDRHR"
FT                   /protein_id="YP_003165456.1"
FT   misc_feature    208138..>208512
FT                   /note="Phage portal protein; Region: Phage_portal; cl01923"
FT                   /db_xref="CDD:186498"
FT                   /locus_tag="CAP2UW1_0168"
FT   misc_feature    <208510..208806
FT                   /note="Phage portal protein; Region: Phage_portal; cl01923"
FT                   /db_xref="CDD:186498"
FT                   /locus_tag="CAP2UW1_0168"
FT   gene            209126..209518
FT                   /db_xref="GeneID:8402295"
FT                   /locus_tag="CAP2UW1_0169"
FT   CDS_pept        209126..209518
FT                   /locus_tag="CAP2UW1_0169"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase S49"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase S49; KEGG: bph:Bphy_7143 peptidase
FT                   S49"
FT                   /db_xref="GI:257091816"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="GeneID:8402295"
FT                   /translation="MVAIANRLAASGSYWIGCSASEFYVAPGGEVGSIAVWQAYFDYSQ
FT                   AFAAGGVKPTLISAGKYKVEGNPCAPLDEEAQGLMQSRVDDYYTSFTKVVARGRAVPIA
FT                   QVRDGMGQGRVLGADAAYAQRASEIL"
FT                   /protein_id="YP_003165457.1"
FT   misc_feature    <209126..209488
FT                   /note="Signal peptide peptidase A (SppA) 36K type, a serine
FT                   protease, has catalytic Ser-Lys dyad; Region:
FT                   S49_Sppa_36K_type; cd07022"
FT                   /db_xref="CDD:132933"
FT                   /locus_tag="CAP2UW1_0169"
FT   misc_feature    order(209156..209158,209201..209203,209207..209209,
FT                   209231..209242,209387..209389,209456..209461,
FT                   209468..209470,209474..209476,209483..209485)
FT                   /note="tandem repeat interface; other site"
FT                   /db_xref="CDD:132933"
FT                   /locus_tag="CAP2UW1_0169"
FT   misc_feature    209156..209158
FT                   /note="active site residues"
FT                   /db_xref="CDD:132933"
FT                   /locus_tag="CAP2UW1_0169"
FT   misc_feature    order(209279..209281,209285..209299,209381..209383,
FT                   209393..209395)
FT                   /note="oligomer interface; other site"
FT                   /db_xref="CDD:132933"
FT                   /locus_tag="CAP2UW1_0169"
FT   gene            209849..210514
FT                   /db_xref="GeneID:8402296"
FT                   /locus_tag="CAP2UW1_0170"
FT   CDS_pept        209849..210514
FT                   /locus_tag="CAP2UW1_0170"
FT                   /gene_family="HOG000219804" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_3104 hypothetical protein"
FT                   /db_xref="GI:257091817"
FT                   /db_xref="GeneID:8402296"
FT                   /translation="MEILIDIILKAGRSAVELAFFVLLPVMVVMLTLMRMLEAQGMLDW
FT                   LAQRLAPALRPFGLGGLGVFAALQINFVSFAAPIATLTMMEQRGASDRHIAATLAMVFS
FT                   MSQANAAFPMMTMGLNFGTTLAFSLVGGLAAASATYYLFGRHLSAAEGVVDETLPHQSA
FT                   DSAKGVLDVINRAGAEAFKIAVGAIPMLVLSLVVVIALKRFGVIDLLTEWLTPPMLPT"
FT                   /protein_id="YP_003165458.1"
FT   gene            210781..211884
FT                   /db_xref="GeneID:8402297"
FT                   /locus_tag="CAP2UW1_0171"
FT   CDS_pept        210781..211884
FT                   /locus_tag="CAP2UW1_0171"
FT                   /gene_family="HOG000056408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   cti:RALTA_p0602 putative transposase, IS4 family"
FT                   /db_xref="GI:257091818"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402297"
FT                   /translation="MQSELDAFFANLANRADLLREVSAQAFAKARKQVSATAFELLNDH
FT                   FLALVDTQFGFPLWRGLRVVAGDATVLRLTLFGKTRDGRPFVRHVVDAIGFALYLPGIE
FT                   MTLAATLYSPDVGERQMLFEHLDKLRSKDILVLDRGYPAYWLFAALLQRGRHFCMRADS
FT                   LNFSAIQAFRRSGLAEQIVRLPAPCKQDALDYEIAATPCEVRLIRQVFGHKVRVLVTSL
FT                   LDLDAYPAAEFGALYHSRWRIEEAFKRIKHRLALEHLSGMSWLAARQDFGAKILCDNIN
FT                   ALAVHAASESLDPNTRASYFINRGDTFSRIKRTLGRWLLQGRDALDNITSVFNELIKNL
FT                   VQIKPNRSYPRKFTQKPHLSHAYKSGV"
FT                   /protein_id="YP_003165459.1"
FT   misc_feature    210955..211620
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="CAP2UW1_0171"
FT   gene            212178..212702
FT                   /db_xref="GeneID:8402298"
FT                   /locus_tag="CAP2UW1_0172"
FT   CDS_pept        212178..212702
FT                   /locus_tag="CAP2UW1_0172"
FT                   /gene_family="HOG000158229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: drm:Dred_0563 hypothetical protein"
FT                   /db_xref="GI:257091819"
FT                   /db_xref="GeneID:8402298"
FT                   /translation="MQRIVAGITTLEQHVETTQKAAEVYRPKSCPHCGLGVVHQHGHYE
FT                   RKADRRAVPPRLNPIPILRYRCAGCRRTCSRLPECIAPRRWYDWSVQQQVLQQRLNGAA
FT                   EHPGGPPDRHTGARWWNWLQERGKDFVFHLRVRFAELGRAVDTHGFWHQVFNSLGLPRA
FT                   MFWLDQEMSVP"
FT                   /protein_id="YP_003165460.1"
FT   gene            212832..214154
FT                   /db_xref="GeneID:8402299"
FT                   /locus_tag="CAP2UW1_0173"
FT   CDS_pept        212832..214154
FT                   /locus_tag="CAP2UW1_0173"
FT                   /gene_family="HOG000220570" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG: gka:GK0880
FT                   IS1604-like transposase"
FT                   /db_xref="GI:257091820"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:8402299"
FT                   /translation="MNRINPIALFRLSVLGSLTSRERLDHGELQQTIRALAEREYTIPG
FT                   TRRRHVAEKTIQGWYYTYLAQGIDGLTPKTRIDRGQSKLSQAIQTAILAAKRDNPRRSI
FT                   RQIRQLLEATGTVARGSLSRSTVHRLLQQHGLSRISGSASLPEEKRSFVAASAGAIWYG
FT                   DVMHGPRVPHEGKLVKGYLVSLFDDASRLVAHSAFCPGETALDIEGVLKQALLKRGIPI
FT                   KLVVDNGAAYRAETLQGICARLGIHLIYCRPYAPEGKGKLERWHRTCRDQFLSELDERH
FT                   INSFEDLNARLWAWLERVYHHTPHAGLDGMTPLARYQQDLSKIRSLGALAAQLDALFRY
FT                   RVSRRVRKDGTVSYQGARFEVPFELSGKTVCLVVDPHSGAVIEVEDEHGKGIGAATPLD
FT                   ALGNLDRQRNKSDPTDAAPASPSGPNLIELTYRQYYDRKGD"
FT                   /protein_id="YP_003165461.1"
FT   misc_feature    213303..213635
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_0173"
FT   gene            214157..214951
FT                   /db_xref="GeneID:8402300"
FT                   /locus_tag="CAP2UW1_0174"
FT   CDS_pept        214157..214951
FT                   /locus_tag="CAP2UW1_0174"
FT                   /gene_family="HOG000158228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AAA ATPase"
FT                   /transl_table="11"
FT                   /note="SMART: AAA ATPase; KEGG: gka:GK1917 hypothetical
FT                   protein"
FT                   /db_xref="GI:257091821"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:8402300"
FT                   /translation="MYLQHFGLRHPPLGKDAAELWDDGALAQLAERFQWLLQSPGLGLL
FT                   TGEAGVGKTAALRLVTAKLNPHRYQVIYHAETDFGRADLYRCLAQSLGLQPSYRRAQLW
FT                   RDIKAHIHHLADAKQLLPVWILDEAQNLPPEFFRDFPAFLNFAFDSRDLITVWLVGHPI
FT                   LAQTLERASYAALAGRIQARVHLRPVLERERFAQLVGHALKSAGCAHTLLTDSGLELLR
FT                   QASKGLPRHAGRILRTAMRLAVPRALNHLPDDLLQAAIEELR"
FT                   /protein_id="YP_003165462.1"
FT   misc_feature    214157..214885
FT                   /note="Type II secretory pathway, component ExeA (predicted
FT                   ATPase) [Intracellular trafficking and secretion]; Region:
FT                   ExeA; COG3267"
FT                   /db_xref="CDD:33078"
FT                   /locus_tag="CAP2UW1_0174"
FT   misc_feature    214157..214846
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="CAP2UW1_0174"
FT   gene            214948..215145
FT                   /db_xref="GeneID:8402301"
FT                   /locus_tag="CAP2UW1_0175"
FT   CDS_pept        214948..215145
FT                   /locus_tag="CAP2UW1_0175"
FT                   /gene_family="HOG000158227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cti:RALTA_p0541 hypothetical protein"
FT                   /db_xref="GI:257091822"
FT                   /db_xref="GeneID:8402301"
FT                   /translation="MKRRPHSLFPDGLSDESAAAISEFLHQLAAACEARYLVQLRRHRS
FT                   RQMNLYDPEAPWRIPPGEPF"
FT                   /protein_id="YP_003165463.1"
FT   gene            complement(215344..216669)
FT                   /db_xref="GeneID:8402302"
FT                   /locus_tag="CAP2UW1_0176"
FT   CDS_pept        complement(215344..216669)
FT                   /locus_tag="CAP2UW1_0176"
FT                   /gene_family="HOG000228794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3230 transposase"
FT                   /db_xref="GI:257091823"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402302"
FT                   /translation="MGWAGEELKEVDLGDRRLNKRAITLLDTLAAKPTPSIPSACSGWS
FT                   ETIAAYRFLDNDAVTWEGILRPHWSCSRTRIACHKVVLMLQDTTELDFNGQSIDGLGPL
FT                   SYEAQRGLYVHPTYAVSTDREPLGVLDAWMWAREPKDANGQRPGIKESTRWVEGYERVA
FT                   ELAAELPDTRLVYVADRESDMIELMARAGELETPADWLLRAQHDRALPDGQKLWQTVTS
FT                   GEELGGISFTLPARDGQKARVVRQQLWARVVDLPHGKNKTIRATCVVAKEIDPPAGSTP
FT                   VEWRLLTNRTAETLAEVAELIDWYRARWEIEILFHILKNGCRIESLQLRTIDGLQRAIA
FT                   LYLIVSWRIAMLMRFGRTCPDLPADLFFDQDEWHAAYLLNKKKPPADPPTLNQVLRLVA
FT                   MLGGFLARKGDGEPGVKTIWIGLQRVMDFVVGLQFMREAAPG"
FT                   /protein_id="YP_003165464.1"
FT   misc_feature    complement(215641..>215835)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="CAP2UW1_0176"
FT   gene            217277..218146
FT                   /db_xref="GeneID:8402303"
FT                   /locus_tag="CAP2UW1_0177"
FT   CDS_pept        217277..218146
FT                   /locus_tag="CAP2UW1_0177"
FT                   /gene_family="HOG000247788" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: cph:Cpha266_1254 peptidase C14, caspase catalytic
FT                   subunit P20"
FT                   /db_xref="GI:257091824"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="GeneID:8402303"
FT                   /translation="MAGKKALFVGINKFANYSQFTLNGCVNDAKDMAALYKDLLGFKTT
FT                   EMSTLTDAQATKANIMARLNAMVADAKAGKLNYLVFSLSSHGTQMNDTSGDEPDGKDEA
FT                   FVPHDIAEKNGAWDPARIISDDEFHDLFVQLPANVLLEVYLDTCHSGTGLRGAEFGLHA
FT                   PRARYIAPPDHEFEQKTAKMRGFALDRPPAGSAKKGAAEASKAAVAGAHHVLWTGCKAN
FT                   QTSADAYFNGRYNGAFTYYFVKVMRDTQNKLSRKAVIAKMRALMKSGFAQTPQLEGNAT
FT                   NRGQAIVY"
FT                   /protein_id="YP_003165465.1"
FT   misc_feature    217286..218107
FT                   /note="Caspase, interleukin-1 beta converting enzyme (ICE)
FT                   homologues; Cysteine-dependent aspartate-directed proteases
FT                   that mediate programmed cell death (apoptosis). Caspases
FT                   are synthesized as inactive zymogens and activated by
FT                   proteolysis of the peptide...; Region: CASc; cl00042"
FT                   /db_xref="CDD:185785"
FT                   /locus_tag="CAP2UW1_0177"
FT   gene            complement(218302..218823)
FT                   /db_xref="GeneID:8402304"
FT                   /locus_tag="CAP2UW1_0178"
FT   CDS_pept        complement(218302..218823)
FT                   /locus_tag="CAP2UW1_0178"
FT                   /gene_family="HOG000257431" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pla:Plav_3056 hypothetical protein"
FT                   /db_xref="GI:257091825"
FT                   /db_xref="GeneID:8402304"
FT                   /translation="MAIPLYDVSVSSFLQVLGAVSGFLDKGASHCRETGTDPNDIVEMR
FT                   LYPDMLPFRFQIISVAHHSKGAIDGVQSGVFAPPTGMADQDYAALQAIVADARSALEKL
FT                   TRETVDAMQGKEVVFKFGERSIPFTAEGFLMSFSLPNLHFHATTAYDMLRMRGVPLSKR
FT                   DYLGRMQIKS"
FT                   /protein_id="YP_003165466.1"
FT   misc_feature    complement(218323..218811)
FT                   /note="Domain of unknown function (DUF1993); Region:
FT                   DUF1993; cl01567"
FT                   /db_xref="CDD:154475"
FT                   /locus_tag="CAP2UW1_0178"
FT   gene            complement(219078..220532)
FT                   /db_xref="GeneID:8402305"
FT                   /locus_tag="CAP2UW1_0179"
FT   CDS_pept        complement(219078..220532)
FT                   /locus_tag="CAP2UW1_0179"
FT                   /gene_family="HOG000236759" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /transl_table="11"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   mpt:Mpe_A1439 hypothetical protein"
FT                   /db_xref="GI:257091826"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="GeneID:8402305"
FT                   /translation="MNTDRISLSLISHTNAGKTTLARTLLGRDVGEVRDAPHVTLEATG
FT                   HSLISTPEGDELLLWDTPGFGDSARLARRLQQQGNPIGWFLAQVWDRFRDRAFWLSQQA
FT                   VRNVREQADVVLYLVNASEEPADVGYLAPELAVLEWIGKPVIVLLNQTGRPRPGDEEAA
FT                   DRERWHGALAGYRFVRAVLPLDAFARCWVQEITLLRAVGGVLPVERTAAYGRLVAAWQV
FT                   RREAQFDAAMALLAETLARAVADCETLPEKRLQGALRDLGRAIGVGRDDGGGDQARAVQ
FT                   ALAARLDANLRASMDRLLAIHELEGQAGSELLGRMARTVTLAAPVNAGKAALMGGALSG
FT                   ALTGLGADLMAGGLTFGAGLLTGAVLGALGGAGMARGVNRARGRLGTTLRWDDAFLSEL
FT                   VVALLLRYLAVAHYGRGRGEWHETEYPSFWQALVTGVVAENAAALVMVWDGRAADSSTA
FT                   AIARHARPLLAQVARTILARLYPDSF"
FT                   /protein_id="YP_003165467.1"
FT   misc_feature    complement(<220032..220493)
FT                   /note="Era (E. coli Ras-like protein)-like.  This family
FT                   includes several distinct subfamilies (TrmE/ThdF, FeoB,
FT                   YihA (EngG), Era, and EngA/YfgK) that generally show
FT                   sequence conservation in the region between the Walker A
FT                   and B motifs (G1 and G3 box motifs)...; Region: Era_like;
FT                   cd00880"
FT                   /db_xref="CDD:133256"
FT                   /locus_tag="CAP2UW1_0179"
FT   misc_feature    complement(220476..220493)
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133256"
FT                   /locus_tag="CAP2UW1_0179"
FT   misc_feature    complement(order(220074..220076,220080..220085,
FT                   220473..220490))
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133256"
FT                   /locus_tag="CAP2UW1_0179"
FT   misc_feature    complement(220404..220418)
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133256"
FT                   /locus_tag="CAP2UW1_0179"
FT   misc_feature    complement(220413..220415)
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133256"
FT                   /locus_tag="CAP2UW1_0179"
FT   misc_feature    complement(order(220200..220202,220338..220355))
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133256"
FT                   /locus_tag="CAP2UW1_0179"
FT   misc_feature    complement(220341..220352)
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133256"
FT                   /locus_tag="CAP2UW1_0179"
FT   misc_feature    complement(220074..220085)
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133256"
FT                   /locus_tag="CAP2UW1_0179"
FT   gene            complement(220529..221980)
FT                   /db_xref="GeneID:8402306"
FT                   /locus_tag="CAP2UW1_0180"
FT   CDS_pept        complement(220529..221980)
FT                   /locus_tag="CAP2UW1_0180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mpt:Mpe_A1440 hypothetical protein"
FT                   /db_xref="GI:257091827"
FT                   /db_xref="GeneID:8402306"
FT                   /translation="MNEREALLTTALRVVETVDRDGHLWTDEDRAWASHAAAEVVGEGA
FT                   SPAAFVARRAGLAFERLRSRDQAFVAAVDGLGWRPWIGTAVIVLAFLAGVVIDHLGGGQ
FT                   RINLLAPPILGLLVWNLTVYLLIVVGWLRHQLGQAPAWSTVRRILVRWATGRDGWLRQR
FT                   GMHLPASVLARLISDWSTVAAPLYASRATRILHLAAALFAVGVVAGFYLRGLAFEYRAG
FT                   WESTFLGSEAVHRLLALMLAPGVWLTGQPLPDVEALAAIRFGVSPPTENAALWLHRLAA
FT                   TIVIVVVAPRLLLALLNALIERQRSADLIDRFDDPYFQRLLRGYRSTPLNLTVIPYSYH
FT                   PLPAALAGLQRVLARIFGSSAAMLCTPPVSYGEEDAPPSAARLDGNSPVFALFSLAATP
FT                   ENETQGAFVRALRSFASGAPVLLLVDEGPWRARFAADERRLAERRSAWRAQFADLALVP
FT                   IFLDLTTPDLAAAQSEIERRLEAAG"
FT                   /protein_id="YP_003165468.1"
FT   misc_feature    complement(220613..221497)
FT                   /note="Protein of unknown function (DUF2868); Region:
FT                   DUF2868; pfam11067"
FT                   /db_xref="CDD:151512"
FT                   /locus_tag="CAP2UW1_0180"
FT   gene            complement(222014..223474)
FT                   /db_xref="GeneID:8402307"
FT                   /locus_tag="CAP2UW1_0181"
FT   CDS_pept        complement(222014..223474)
FT                   /locus_tag="CAP2UW1_0181"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: bra:BRADO3979 conserved hypothetical protein;
FT                   putative peptidase (caspase-like)"
FT                   /db_xref="GI:257091828"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="GeneID:8402307"
FT                   /translation="MPAVRRCLRLLATILLWLGCGALAAAPAATPGKGQVALVVGIGAY
FT                   QNAPPLPNPPKDARALADSLKKLGFQVELAIDPDKTRLEQAVKRFGDQLQGAKVGLFFY
FT                   AGHGLQVSGRNYLVPADAKIDNERSLPFAAVDADLVLTQMETSTPISLVFLDACRDNPF
FT                   SRSLARSMGTRSAAVGRGLAQIAAGEGSLIVFATQPGNVAEDGKADHSPFTEALLKNLA
FT                   APGLEVRQMLTRVRQQVKEQTNGKQIPWDHSSLTQDYYFLGPTTVVVQPQAAPAAQPKA
FT                   AGVDPMAVQLSLWESVRTSQDPADFEDYLKQYPDGKFAAIARRRVAALKTASLKEREPA
FT                   AKEPAAQPQPPPARPAAPVERQPAKASPAPPVAAPDAQAQAAFDVMMQGTATNLTVGTT
FT                   AQVQFQLRRSGSGVTAAIRVFPPLYATGVLQGQYQGGQCLMQGWMNEGFLLKMAGACSA
FT                   GSFSGQYQAESPGLVQQGVFRLQSRATN"
FT                   /protein_id="YP_003165469.1"
FT   sig_peptide     complement(223397..223474)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.640 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_0181"
FT   misc_feature    complement(222692..223309)
FT                   /note="Caspase, interleukin-1 beta converting enzyme (ICE)
FT                   homologues; Cysteine-dependent aspartate-directed proteases
FT                   that mediate programmed cell death (apoptosis). Caspases
FT                   are synthesized as inactive zymogens and activated by
FT                   proteolysis of the peptide...; Region: CASc; cl00042"
FT                   /db_xref="CDD:185785"
FT                   /locus_tag="CAP2UW1_0181"
FT   misc_feature    complement(order(223001..223003,223154..223156))
FT                   /note="active site"
FT                   /db_xref="CDD:28914"
FT                   /locus_tag="CAP2UW1_0181"
FT   misc_feature    complement(order(222839..222844,222854..222871,
FT                   223007..223009,223151..223153))
FT                   /note="substrate pocket; other site"
FT                   /db_xref="CDD:28914"
FT                   /locus_tag="CAP2UW1_0181"
FT   misc_feature    complement(order(222701..222706,222713..222715,
FT                   222719..222724,222737..222739,222767..222769,
FT                   222785..222787,222872..222874,222881..222883,
FT                   222890..222892,222911..222916,222995..222997))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:28914"
FT                   /locus_tag="CAP2UW1_0181"
FT   misc_feature    complement(order(222917..222919,222992..222994))
FT                   /note="proteolytic cleavage site; other site"
FT                   /db_xref="CDD:28914"
FT                   /locus_tag="CAP2UW1_0181"
FT   gene            complement(223604..224368)
FT                   /db_xref="GeneID:8402308"
FT                   /locus_tag="CAP2UW1_0182"
FT   CDS_pept        complement(223604..224368)
FT                   /locus_tag="CAP2UW1_0182"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   aeh:Mlg_1464 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="GI:257091829"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:8402308"
FT                   /translation="MRRVVFNQKGGVGKSTIACNLAAIAAARGRRTLLIDLDSQANASR
FT                   YVLGKALDEQKKTLAHYFDDILGYRLFPEALDAYVIHTPFANLDVLPSDSRLEELQVKL
FT                   ESRYKMYKLRESLDKLAGYDEIFIDTPPALNFFTRSALIAADTCLIPFDCDDFSRRALY
FT                   TLMDNVREIQADHNRALRVEGIVVNHYQARANLPLRLVDELRGEGLPILDAFLSASIKI
FT                   RESHHQALPMIHLDPRHKLTGEFAALYDLLSQ"
FT                   /protein_id="YP_003165470.1"
FT   misc_feature    complement(223613..224368)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="CAP2UW1_0182"
FT   misc_feature    complement(223805..>224002)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_0182"
FT   misc_feature    complement(223982..223984)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="CAP2UW1_0182"
FT   gene            complement(224462..225172)
FT                   /db_xref="GeneID:8402309"
FT                   /locus_tag="CAP2UW1_0183"
FT   CDS_pept        complement(224462..225172)
FT                   /locus_tag="CAP2UW1_0183"
FT                   /gene_family="HOG000260139" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   azo:azo2859 probable carboxylesterase"
FT                   /db_xref="GI:257091830"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="GeneID:8402309"
FT                   /translation="MNAKPTPSTADALLLPAVECRTGDSPQCAIIWLHGLGADGHDFEP
FT                   IVDEFDFDQLPAIRFVFPHAPMRAVTINGGYVMRAWYDIVSPDFAPGREEAEGVRQSAE
FT                   QIEALIARENARGIPDGRIVLAGFSQGGVIALHTGLRHPQRLAGVLALSCYLPLVDTLP
FT                   AEAHPANRDVPIFMAHGRNDPVIPYDFGKRSAKLLKVQGYALQWHGYAAEHTVCMEELR
FT                   DIEGWLQQILAAAC"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165471.1"
FT   misc_feature    complement(224486..225127)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="CAP2UW1_0183"
FT   misc_feature    complement(224486..225106)
FT                   /note="Predicted esterase [General function prediction
FT                   only]; Region: COG0400"
FT                   /db_xref="CDD:30749"
FT                   /locus_tag="CAP2UW1_0183"
FT   gene            complement(225296..226390)
FT                   /db_xref="GeneID:8402310"
FT                   /locus_tag="CAP2UW1_0184"
FT   CDS_pept        complement(225296..226390)
FT                   /locus_tag="CAP2UW1_0184"
FT                   /gene_family="HOG000021112" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase;
FT                   KEGG: bra:BRADO2458 putative 3-isopropylmalate
FT                   dehydrogenase (LeuB)"
FT                   /db_xref="GI:257091831"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="GeneID:8402310"
FT                   /translation="MKRDLRFHIAVLPGDGIGPEIVASSLHVLEVLNERMGGIGFDFWH
FT                   LEGGAAHYQKTGTAFSDENMAACKKADAVLLGAIGLPHVRYSDGTEVTTQLDLRVEMDL
FT                   YAGLRPIRSYPSLPRVLVDKRASQIDLVLVREQTEGILYSRCRGTIEDDRVAWETMMIS
FT                   RNGTSRVSEFAFRVAERRAKSRRRPGKVLCVDRSNALTSMAFFRRIFGEVAERHPSVSA
FT                   DYAYVDTTAMKLVKSPWEFDVLVTENAFGGILSDLAAGVVGSLGLAPSADIGEKHAVFQ
FT                   PAHGSAPHIAGQGLANPVAQILSVALMLDWLADQHGEPRLAHGARILEHAVEKALTVVC
FT                   PVEFGGKDGTAAITKAIIAQIRKS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165472.1"
FT   misc_feature    complement(225383..226372)
FT                   /note="Isocitrate/isopropylmalate dehydrogenase; Region:
FT                   Iso_dh; cl00445"
FT                   /db_xref="CDD:185999"
FT                   /locus_tag="CAP2UW1_0184"
FT   gene            226683..227903
FT                   /db_xref="GeneID:8402311"
FT                   /locus_tag="CAP2UW1_0185"
FT   CDS_pept        226683..227903
FT                   /locus_tag="CAP2UW1_0185"
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG: fps:FP1733
FT                   Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="GI:257091832"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="GeneID:8402311"
FT                   /translation="MAFNPASRVQDYLVFGEFGDVNPSITDSSTYTFLSPERMAELFEH
FT                   EIEGCFLYSRHFNPTNKYLASALERMEDGESAQVMASGMGAISTTLMTLCGAGDEIVCG
FT                   RSIYGGTYALLKNLLPRFGVNTRFVDLCDHDAVRAAMTPRTRVVYCESLSNPLLEVSDL
FT                   PALAAIAHAGGARLVVDNTFTPMILSPLRHGADVVVHSLTKFVNGTSDCVAGCVVSSRE
FT                   FIARLNDINAGPSMLLGPVLDSTRAASILKNLHSLHVRLRQHGANALYLASRLETLGYP
FT                   VHYPGLASHPHHALLARLMNHGYGWGGMLTLDAGNHAAANRLMTLLQRDKVGYLAVSLG
FT                   YFKTLFTTPGHSTSSEIPLDERAAAGLSDGLIRFSIGLDEDIAQTMVRIEHCLAEANVM
FT                   PAAGAGV"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165473.1"
FT   misc_feature    226734..227828
FT                   /note="Cys/Met metabolism PLP-dependent enzyme; Region:
FT                   Cys_Met_Meta_PP; pfam01053"
FT                   /db_xref="CDD:144590"
FT                   /locus_tag="CAP2UW1_0185"
FT   misc_feature    226737..227864
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:185903"
FT                   /locus_tag="CAP2UW1_0185"
FT   misc_feature    order(226929..226934,226941..226943,227133..227135,
FT                   227220..227222,227229..227231,227283..227285,
FT                   227292..227294)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="CAP2UW1_0185"
FT   misc_feature    227292..227294
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="CAP2UW1_0185"
FT   gene            228711..230405
FT                   /db_xref="GeneID:8402312"
FT                   /locus_tag="CAP2UW1_0186"
FT   CDS_pept        228711..230405
FT                   /locus_tag="CAP2UW1_0186"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS66"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS66; KEGG: fra:Francci3_1922
FT                   transposase IS66"
FT                   /db_xref="GI:257091833"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="GeneID:8402312"
FT                   /translation="MGSGSDISYAGPSTSNGKPTPFAQVMVTLSKEAEIKLRSEANYWK
FT                   SQHQQALARLAQREADHRLAMAQAAAREAALRSELEKAEGKLRDLQKRLFGRKSERRSR
FT                   TEKDAASNDQKSARPRGQRPGVAGHGRRLESHLPAQVETIELDCPHCPECGLGYADFPG
FT                   TEDSEILEIDVKPYRRVIRRRRYRRTCRCPGTPGILSAPPPARLIARGKYGVSIWVHLL
FT                   LSKFSYGQPTHRLLRDWSDYDLTLSPGTLTGGLRALAPLFEPLEDALRCRLQSENRWHA
FT                   DETRWMVFAETEGKIGHRWYLWVFHSESVIHFVLDPTRSAQVPIAELSASQGGIVICDR
FT                   YSGYKKLARILGTILLAFCWAHQRRDFIELANAHPELSEWALSWVERIGELYLLNDARL
FT                   AVRADPVQWAARDDGLRQRVAQMANQREAERANPALKAPARKVLQSMQKHWSGLTVFVD
FT                   HPEVPMDNNVAERDQRTPVVARKNFYGSGSPWSGALAATMFSLLMTMRLWGINPRTWLT
FT                   AYLDACAANGSQPPADLSVFLPWAMDADLLAQRRRAAMDPADPIDSS"
FT                   /protein_id="YP_003165474.1"
FT   misc_feature    229284..229751
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_0186"
FT   gene            230402..231259
FT                   /db_xref="GeneID:8402313"
FT                   /locus_tag="CAP2UW1_0187"
FT   CDS_pept        230402..231259
FT                   /locus_tag="CAP2UW1_0187"
FT                   /gene_family="HOG000095951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_2941 hypothetical protein"
FT                   /db_xref="GI:257091834"
FT                   /db_xref="GeneID:8402313"
FT                   /translation="MKPYCGRQFTLDELQTLRHLIEANPSASRAQLSRQVCALLDWFKP
FT                   NGELKDMTCRVAMLRMQADGLLTLPAAQRCAPRQPEYLATAATDPQSLLVRPVHELPPL
FT                   HLRQVSGSAHSRLWNEYIARYHYLGYTPMAGSQSRYFVFAGEHRVALLSFGASAWKLAA
FT                   RERFIGWQEDERQRNLPLVVNNARFLILPWIQSKGLASKILAIIHRQLPNDWLARYGYR
FT                   PVLLETFVETPRHRGTCYQAANWIKVGQTTGRGKKCPTSKPILPIKDIWLYPLHRNFRS
FT                   ILCR"
FT                   /protein_id="YP_003165475.1"
FT   gene            231902..233494
FT                   /db_xref="GeneID:8402314"
FT                   /locus_tag="CAP2UW1_0188"
FT   CDS_pept        231902..233494
FT                   /locus_tag="CAP2UW1_0188"
FT                   /gene_family="HOG000229041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_4966 hypothetical protein"
FT                   /db_xref="GI:257091835"
FT                   /db_xref="GeneID:8402314"
FT                   /translation="MATPAIGLGYPEWTTKAEKRGLDPLGMQTTSVALYQLLLPGISNV
FT                   TLRMRYYGFYAWLAQRYAKDLGDTSVERWCLYLRRAEALYSLIAVHAGAERGVAGVDWA
FT                   SRAFAASGPEVAFHPATDRGEGAPQYLKQKFGAFGAAYGSQLLDIGVLEVVPGHRVPVP
FT                   TRGIGDKLANAFESAIGASADAFIAAAKAGTVGKSSLTSLAPMLPSRIAATGPERDLYE
FT                   ELLLVGDPAQKPRATSRSHSLRLVLRIASDQRTSLRVDTLRWSLYASQCGGAPALTALG
FT                   AEEDQQRFAWAVYQANDLLHVSYETILKLALDILGGAPTGMPFEALLAQTVSRLMSALG
FT                   SHSVESWNELIASLVLAKDPVSEKDPMSEFMLQQTAFRSSRPEVVTSEDSARCSVLLLA
FT                   VLHKRFGDLLERIAREFPVLAQGDFLRSIVTEMRFLDEHATERFESLLARIVKQRVLDR
FT                   HLWVAIQKFRGPAGDYTFLIEADDGRMRLRQKDGPVLTNPRLSSAIAFLQDTHLLGPDG
FT                   PTPAGLRLIQEAA"
FT                   /protein_id="YP_003165476.1"
FT   gene            233491..235977
FT                   /db_xref="GeneID:8402315"
FT                   /locus_tag="CAP2UW1_0189"
FT   CDS_pept        233491..235977
FT                   /locus_tag="CAP2UW1_0189"
FT                   /gene_family="HOG000229040" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_4965 hypothetical protein"
FT                   /db_xref="GI:257091836"
FT                   /db_xref="GeneID:8402315"
FT                   /translation="MKLFNCFSASGYHSSIITTFGIDFDAYEAIALPRLRDAGCNNNIV
FT                   VADARMLVQALGDGAHRPKFAGRRYSVVGTQCAGVFHPKLILQLGKASGRLLVTSANMT
FT                   TAGMAGNFEVAGEVAVAEDAMEAAPLLRAAVDYLLRFLAPASVARRQVEWTLKRARWLP
FT                   ASASPEAVVALQDGMRVAFLARNDGKGIAERFLEFVGDRVVTRLVVVSPYWDHDLRSLR
FT                   GLCDRFGAAKGAAFIQPQSALFPVHAHASAGPLALFDLNRVPGTASRFAHAKLFIAEGD
FT                   SGDCVLFGSANCTEAALGTSGQAGINEEACLARDLPAGDAVRLLGLEEALSAGAELAVS
FT                   SVPSFSPADDIPLSDLAARLPGRFELAGELLRWWPPSGLLSDEAAIRLLDQRGAPVAGS
FT                   LSRLGTQGSPANYRFDGTVAPHFAQVHQGQFVSSLAVVVVEQSIHESQRRAAGRGLANV
FT                   LDLLDDDEASEGLWLLEVIQKITEAEHEMRGPRGAAEQPPQQRPTTDAAPDSRVLSYDE
FT                   FVAGRRAEDGRTASAGSHLAATHQESVRSFLNALIGKRAVLEFSESQEDEGPVPDLGLG
FT                   DETADGAGAMESGDLPQSAPDGTGADQTAEAKRQLRQRQRYVQDTQRSIIDAVEAFLRG
FT                   LREQANGQSLGVVDLLRLRALLIVVLGAGSKKTDLLPRDLATQVRRRQVLPSVGEASWR
FT                   RLVGRLLYDFFRDRLGTRAPLIQSLRLESDGDMGLPEDVLECWATCFWATCAMREAVND
FT                   VGAPFHVTKSENMLAADLYRFTRLLPEQALGAVVHEVFSGMSRRYGDRLGVSAERVDQA
FT                   HLALVEPARIQSYAAR"
FT                   /protein_id="YP_003165477.1"
FT   gene            complement(236152..236607)
FT                   /db_xref="GeneID:8402316"
FT                   /locus_tag="CAP2UW1_0190"
FT   CDS_pept        complement(236152..236607)
FT                   /locus_tag="CAP2UW1_0190"
FT                   /gene_family="HOG000005294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mms:mma_2737 hypothetical protein"
FT                   /db_xref="GI:257091837"
FT                   /db_xref="GeneID:8402316"
FT                   /translation="MNGIRIRKTGAPDVIAASDGRLTLSVPIQIKRRSGRKLVTLPSGE
FT                   SAQPRPWDVAATPMQLALARGHRWLAMLESGEAQSITELAAREKIDNSYMCRMLNLTTL
FT                   APDIVEAILDETLPPHVTVHELAISPPVLWEEQHARIGVVGEEIQPE"
FT                   /protein_id="YP_003165478.1"
FT   gene            complement(236604..237962)
FT                   /db_xref="GeneID:8402317"
FT                   /locus_tag="CAP2UW1_0191"
FT   CDS_pept        complement(236604..237962)
FT                   /locus_tag="CAP2UW1_0191"
FT                   /gene_family="HOG000005305" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   mms:mma_2738 site-specific integrase/recombinase protein"
FT                   /db_xref="GI:257091838"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="GeneID:8402317"
FT                   /translation="MSEALKRRVRCAVYTRKSTDEGMDQEYNSIDAQRDAGHAYIASQR
FT                   AEGWIPVADDYDDPAFSGGHMERPALRRMMADIEAGRIDVVVIYKIDRLTRSLADFSKM
FT                   VEVFERYGVSFVSVTQQFNTTTSMGRLMLNILLSFAQFEREVTGERIRDKIAASKVKGM
FT                   WMGGVPPLGYDVENRRLVLNEQEAKLIRHIFQRFFELGSSTALFNELKLDGVTSKAWTT
FT                   QDGKVREGRPIDKGMIYKLLNNRTYLGELRHKEQWVPAAHPPIIERELWDSVHAILSTN
FT                   CRVRGGVTQAVVPFLLKGIVFGNDGRALSPWHSTKKSNGRRYRYYIPMRDTKEQAGASG
FT                   LPRLPAAELESAVLEQLRGILRAPALLGDLLSQASKLDPTLDEAKVTVAMTRLDAIWDQ
FT                   LFPAEQTRIVRLLVEKVIVSPTDMELRLRANGIERVVLDLRREPAERRQEVLA"
FT                   /protein_id="YP_003165479.1"
FT   misc_feature    complement(237228..237935)
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(237504..237923)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(order(237675..237677,237684..237689,
FT                   237909..237911,237915..237917))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(237909..237911)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(order(237534..237536,237546..237551,
FT                   237555..237560,237690..237692))
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(order(237528..237530,237537..237539,
FT                   237546..237551,237558..237563,237570..237572,
FT                   237654..237659,237672..237674))
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(order(237513..237515,237525..237527,
FT                   237534..237536,237546..237548,237555..237560,
FT                   237567..237572,237597..237605))
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(order(237513..237515,237525..237527,
FT                   237534..237536,237546..237548,237555..237557,
FT                   237603..237605))
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(order(237510..237515,237531..237533))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CAP2UW1_0191"
FT   misc_feature    complement(237120..237413)
FT                   /note="Recombinase; Region: Recombinase; pfam07508"
FT                   /db_xref="CDD:148873"
FT                   /locus_tag="CAP2UW1_0191"
FT   gene            complement(237959..238255)
FT                   /db_xref="GeneID:8402318"
FT                   /locus_tag="CAP2UW1_0192"
FT   CDS_pept        complement(237959..238255)
FT                   /locus_tag="CAP2UW1_0192"
FT                   /gene_family="HOG000005641" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative bacteriophage related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: neu:NE2540 putative bacteriophage related
FT                   protein"
FT                   /db_xref="GI:257091839"
FT                   /db_xref="GeneID:8402318"
FT                   /translation="MVERNQRRIESLLETGQVRKCDRDTRPAVGTVLTREYRDVEYCVV
FT                   ATGDDQYEFNGRMYPSLSMIAREITGTRWSGPLFFGLKAPAQPATSARKGTRR"
FT                   /protein_id="YP_003165480.1"
FT   misc_feature    complement(238007..>238255)
FT                   /note="Protein of unknown function (DUF2924); Region:
FT                   DUF2924; pfam11149"
FT                   /db_xref="CDD:151592"
FT                   /locus_tag="CAP2UW1_0192"
FT   gene            complement(239058..239525)
FT                   /db_xref="GeneID:8402319"
FT                   /locus_tag="CAP2UW1_0193"
FT   CDS_pept        complement(239058..239525)
FT                   /locus_tag="CAP2UW1_0193"
FT                   /gene_family="HOG000061228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4632 hypothetical protein"
FT                   /db_xref="GI:257091840"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="GeneID:8402319"
FT                   /translation="MKTTFSKLFLARLTVLVLASFAMAPVADAFGGGGGGARAGGGGNR
FT                   EVNTSNRDVRANNVRSTSVNNVNNTNVNVNRNVNVNVDNRGGWDNGYHPVATAAAVTTA
FT                   VVVTSAVVGSMVRTVPANCVPVNYGGLIYQQCGSTWYQPQGSQYVVINPPY"
FT                   /protein_id="YP_003165481.1"
FT   sig_peptide     complement(239436..239525)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.797 at
FT                   residue 30"
FT                   /locus_tag="CAP2UW1_0193"
FT   gene            complement(239538..240263)
FT                   /db_xref="GeneID:8402320"
FT                   /locus_tag="CAP2UW1_0194"
FT   CDS_pept        complement(239538..240263)
FT                   /locus_tag="CAP2UW1_0194"
FT                   /gene_family="HOG000061229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative periplasmic protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4633 putative periplasmic protein"
FT                   /db_xref="GI:257091841"
FT                   /db_xref="GeneID:8402320"
FT                   /translation="MRLAREKCRTRAGTAQQVANAVDPASIQALKDMGAHLQSLKRFQV
FT                   STELTGERVLADGQKLQHSATADLEVDRPNKLRARMFSARSEREIFYNGQMATLYTPAQ
FT                   RYYSTVAFTDTLAVLVTKLQEKYAVQVPLSDLFVWGTAAAPLDKIDSAMNAGQDFVGQD
FT                   LCDHYAFRQGKIDWQVWITTGSKPLPRKIVITNRDDEARPQSVSLLDWNLKPTFTDAVF
FT                   KFTPPKGATEVELRSLDKK"
FT                   /protein_id="YP_003165482.1"
FT   misc_feature    complement(239550..240185)
FT                   /note="Outer membrane lipoprotein carrier protein LolA;
FT                   Region: LolA; cl01065"
FT                   /db_xref="CDD:186316"
FT                   /locus_tag="CAP2UW1_0194"
FT   gene            240384..242063
FT                   /db_xref="GeneID:8402321"
FT                   /locus_tag="CAP2UW1_0195"
FT   CDS_pept        240384..242063
FT                   /locus_tag="CAP2UW1_0195"
FT                   /gene_family="HOG000230291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:p2A221 transposase"
FT                   /db_xref="GI:257091842"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402321"
FT                   /translation="MFVKITTSGPRQYVKLVESYRDTAGVPRQRVIATLGRIESVRSGE
FT                   ADSLLNGLLRAAGKPSLEEGTGEVAFAPALSVGDTWLLTALWKELGFADAFRRLLRNRH
FT                   QFDAERLLRVMVFNRLCDPESKLGILRWLEGTRVPEVSADSVTHQHLLRTMDTLAEGAD
FT                   RVDDALAGLLRPLIDQELAIVFYDLTTIRAEGGTAESEDLRHFGHAKEGGTVRQVMLGV
FT                   VQTAEGLPIHHEVFAGNTGETTTLVPTIEKVLARYPIKRVVLVADRGLLSLDNLDAIRA
FT                   LRVDDQPLEFILAVPARRYGDFDSLLAPFHEKICHSATAEVFGELKWEGFRLIVAHRPD
FT                   MASEQSRVRDERIAALEADAAQWAEKLDAQDAGQTHPGKKLSDAGTIARFYKAVADAHL
FT                   THIIKVNLASEVFTYEIDERALKRARLMDGKLILVANVPDSLPAEIVARYKALADIERG
FT                   FRVLKSEIEIAPVFHRLPDRIRAHALICFLALLLYRVLRLRLKAKASPISPERALEIAR
FT                   RIQYHQITLHQRQSASGLSAITPQQKELFETVALPEPSARRL"
FT                   /protein_id="YP_003165483.1"
FT   misc_feature    240756..241844
FT                   /note="Transposase [DNA replication, recombination, and
FT                   repair]; Region: COG5421"
FT                   /db_xref="CDD:34980"
FT                   /locus_tag="CAP2UW1_0195"
FT   gene            242254..242556
FT                   /db_xref="GeneID:8402322"
FT                   /locus_tag="CAP2UW1_0196"
FT                   /pseudo
FT   gene            242768..244363
FT                   /db_xref="GeneID:8402323"
FT                   /locus_tag="CAP2UW1_0197"
FT   CDS_pept        242768..244363
FT                   /locus_tag="CAP2UW1_0197"
FT                   /gene_family="HOG000135355" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sulfatase"
FT                   /transl_table="11"
FT                   /note="PFAM: sulfatase; KEGG: rba:RB3877 aryl-sulfate
FT                   sulphohydrolase"
FT                   /db_xref="GI:257091843"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="GeneID:8402323"
FT                   /translation="MNKFTWRRAATWLVATAMALIAASPAFAQAQKKPNILVIWGDDIG
FT                   TWNISHTNRGMMGYMTPNIDRIAREGVGFTDYYAQQSCTAGRAAFISGSVPVRSGMTKV
FT                   GLPGAKEGWQKTDVTMATILKSQGYATGQFGKNHQGDRDEHLPTVHGFDEFMGSLYHLN
FT                   AEEEPENRDYPRDLKLPNGKTFLQQFGPRGVIKSKADGKGGQTIENLGPLTKKRMETID
FT                   EESLAAAKEFLTRQAKEGKPFFVWWNATRMHFRTHVKPEHTGISGKSGDEYHDGMVEHD
FT                   MHVGELLKLIDELGLANDTIVQYSTDNGPHYNTWPDAGTTPFRGEKNSNWEGAYRVPAF
FT                   VRWPGHFPAGTTLNGIVSHEDWLPTFAAAAGAPDIKEKLLKGATLNGRSYKNHIDGYNQ
FT                   LDYLSGKTNESPRKEFIYVGDDGAVMAIRVGDWKAVYLENRGYQLDVWREPVAHLRLPL
FT                   VFNLRRDPFEKSQHNSNTYHDWMIDRAYVLIPLQAVATKFLLTLKDFPPSQTPGDWSLD
FT                   SLEKQIKGMTTSGK"
FT                   /protein_id="YP_003165484.1"
FT   sig_peptide     242768..242854
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 29"
FT                   /locus_tag="CAP2UW1_0197"
FT   misc_feature    242855..244174
FT                   /note="Arylsulfatase A and related enzymes [Inorganic ion
FT                   transport and metabolism]; Region: AslA; COG3119"
FT                   /db_xref="CDD:32933"
FT                   /locus_tag="CAP2UW1_0197"
FT   misc_feature    242867..243925
FT                   /note="Sulfatase; Region: Sulfatase; cl10460"
FT                   /db_xref="CDD:186998"
FT                   /locus_tag="CAP2UW1_0197"
FT   gene            244431..245432
FT                   /db_xref="GeneID:8402324"
FT                   /locus_tag="CAP2UW1_0198"
FT   CDS_pept        244431..245432
FT                   /locus_tag="CAP2UW1_0198"
FT                   /gene_family="HOG000000256" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nonspecific acid phosphatase precursor"
FT                   /transl_table="11"
FT                   /note="KEGG: rba:RB6740 nonspecific acid phosphatase
FT                   precursor"
FT                   /db_xref="GI:257091844"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="GeneID:8402324"
FT                   /translation="MKKILSKIAAVLLSAAAAMAFAAPVVDPLPSWNDTASRRAIVEFV
FT                   EKVTHEASPNYVPAPERIATFDNDGTLWAEQPMYFQAFFIVDRIKALAPKHPEWTTQEP
FT                   FASVLKGDMKAALAGGEKALLEMVMATHAGMSTAEFEQIVKDWIATAKHPKTGRPFTEM
FT                   VYQPMLELLAYLRANGFKTYIVSGGGIEFMRPWTEKVYGVPPEQVIGSSIKTKYEIRDG
FT                   KPVLVRLPEINFIDDKAGKPVGINQQIGRRPIAAFGNSDGDLQMLQWTTAGAGPRFALI
FT                   VHHTDAEREWAYDRKSHIGKLDKALDEAQARGWTVVDMRRDWKTVFAAPTKQ"
FT                   /protein_id="YP_003165485.1"
FT   sig_peptide     244431..244499
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_0198"
FT   misc_feature    244920..245237
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="CAP2UW1_0198"
FT   misc_feature    244986..244988
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="CAP2UW1_0198"
FT   gene            245524..245865
FT                   /db_xref="GeneID:8402325"
FT                   /locus_tag="CAP2UW1_0199"
FT   CDS_pept        245524..245865
FT                   /locus_tag="CAP2UW1_0199"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mms:mma_2427 hypothetical protein"
FT                   /db_xref="GI:257091845"
FT                   /db_xref="GeneID:8402325"
FT                   /translation="MVTSAFLWLLPLLMLAPALLAAKRRARPAYAALVGEHERMVHRRW
FT                   ILREPVADPTLLEAAEIGPVADTAAIYHAVKAMRPAPIGMRAMVAIMLPIALPMLLAAA
FT                   LQIQSRISS"
FT                   /protein_id="YP_003165486.1"
FT   sig_peptide     245524..245589
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.803 at
FT                   residue 22"
FT                   /locus_tag="CAP2UW1_0199"
FT   gene            246002..246781
FT                   /db_xref="GeneID:8402326"
FT                   /locus_tag="CAP2UW1_0200"
FT   CDS_pept        246002..246781
FT                   /locus_tag="CAP2UW1_0200"
FT                   /gene_family="HOG000061229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative periplasmic protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4633 putative periplasmic protein"
FT                   /db_xref="GI:257091846"
FT                   /db_xref="GeneID:8402326"
FT                   /translation="MVRKKLVLSLLAISLAAPGIHAQTAPAAAPAAVPAVANAVDPASI
FT                   QALKNMGAYLQTLKRFQVSTELTGERVLADGQKLQHMATADMDVERPNRLHARIWSARA
FT                   ERELIYDGKTATLYTPAQKYYSTVEFSGNLGELINKLEERYGVEVPLADMFIWGTPAAS
FT                   FDKIESAMNAGQDFIGKDLCDHYAFRQGMFDWQIWITTGDKPLPRKLVITNRNDDARPQ
FT                   SLQLIAWNLKPTFKDAVFRFTPPKGATAVEIRPLVQK"
FT                   /protein_id="YP_003165487.1"
FT   sig_peptide     246002..246070
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_0200"
FT   misc_feature    246134..246769
FT                   /note="Outer membrane lipoprotein carrier protein LolA;
FT                   Region: LolA; cl01065"
FT                   /db_xref="CDD:186316"
FT                   /locus_tag="CAP2UW1_0200"
FT   gene            246794..247264
FT                   /db_xref="GeneID:8402327"
FT                   /locus_tag="CAP2UW1_0201"
FT   CDS_pept        246794..247264
FT                   /locus_tag="CAP2UW1_0201"
FT                   /gene_family="HOG000061228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_B4632 hypothetical protein"
FT                   /db_xref="GI:257091847"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="GeneID:8402327"
FT                   /translation="MKKSFSKIFLAPLTVLVLASFAMAPVAEARGGGGHFSGGGGGGNR
FT                   QVNNARADVRTNNVRNTSVNNVNVNRNVNVNANNNRGGCCNGGWDNNYHPVATAAAVTA
FT                   AVVVTSAVVGSMVRTVPAGCVPVNYGGMIYQQCGSTWYQPQGSQYVVINPPY"
FT                   /protein_id="YP_003165488.1"
FT   sig_peptide     246794..246883
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.786 at
FT                   residue 30"
FT                   /locus_tag="CAP2UW1_0201"
FT   gene            complement(247661..248635)
FT                   /db_xref="GeneID:8402328"
FT                   /locus_tag="CAP2UW1_0202"
FT   CDS_pept        complement(247661..248635)
FT                   /locus_tag="CAP2UW1_0202"
FT                   /gene_family="HOG000023135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   pna:Pnap_0429 integrase, catalytic region"
FT                   /db_xref="GI:257091848"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:8402328"
FT                   /translation="MVQQCVLAGVCRSTIYAQQKPAVVDASDLLYSRLIDEEYTRHPFY
FT                   GSRRMVIFLGKAGHTVNRKRVQRLMRLLGLAGMAPGPNTSRPHPEHQVYPYLLRGVPVV
FT                   RPNQVWSTDITYIRLARGFAYLVAVIDWYSRKVLSWRISNSMEAAFCVDCLEDALRTHG
FT                   RPEIFNSDQGSQFTSTAFTDVLKREGVVISMDGRGRVFDNIFVERLWRSVKHEDVYLKG
FT                   YATLGELTVGLAEYFAFYNGERPHQSLSDKTPDVVYRTAIGGGALILDKFGGAGGESPV
FT                   PLRSTGDSPPAEARSTSESTATTKPTAKPGQRRPAATAVESTA"
FT                   /protein_id="YP_003165489.1"
FT   misc_feature    complement(247874..248611)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:177368"
FT                   /locus_tag="CAP2UW1_0202"
FT   misc_feature    complement(247988..248323)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="CAP2UW1_0202"
FT   gene            complement(248674..248973)
FT                   /db_xref="GeneID:8402329"
FT                   /locus_tag="CAP2UW1_0203"
FT   CDS_pept        complement(248674..248973)
FT                   /locus_tag="CAP2UW1_0203"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   pna:Pnap_0430 transposase IS3/IS911 family protein"
FT                   /db_xref="GI:257091849"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:8402329"
FT                   /translation="MSETKTRKVHTPEFKAKVGLEAVRGVKTINEIGQEYGVHPVQVGQ
FT                   WKKAIQDQAKTLFEGKRGPKPLAAHREPERLYSEIGKLKMELDWLKKKSGISPS"
FT                   /protein_id="YP_003165490.1"
FT   gene            248992..249657
FT                   /db_xref="GeneID:8402330"
FT                   /locus_tag="CAP2UW1_0204"
FT   CDS_pept        248992..249657
FT                   /locus_tag="CAP2UW1_0204"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: eba:ebA2691
FT                   phage-related integrase"
FT                   /db_xref="GI:257091850"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:8402330"
FT                   /translation="MAHSLNYCLNSGDHYNRTLSADELRAYLAELGDNLADQALLLTLL
FT                   AGGQRVAQLLRPKVSDYDTGTATLRLWDAKGRTTSPREHLLPLAPRAAALVAHLIARAE
FT                   AKGSPLLFSTYGQTQLADTTPGKRAAEIGAAVTGEPFDLRDIRRTCETMLASMGISRDT
FT                   RAQLLSHGLSGVQVSHYDRDAYTDEKRAALMAWESRLHEIATGTARSNVLSMKQRNAT"
FT                   /protein_id="YP_003165491.1"
FT   misc_feature    <249307..249579
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="CAP2UW1_0204"
FT   misc_feature    order(249415..249423,249529..249531)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_0204"
FT   misc_feature    order(249421..249423,249430..249432,249499..249501,
FT                   249529..249531)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_0204"
FT   misc_feature    order(249421..249423,249430..249432,249499..249501,
FT                   249529..249531)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CAP2UW1_0204"
FT   gene            249688..249966
FT                   /db_xref="GeneID:8402331"
FT                   /locus_tag="CAP2UW1_0205"
FT   CDS_pept        249688..249966
FT                   /locus_tag="CAP2UW1_0205"
FT                   /gene_family="HOG000265985" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid maintenance system killer"
FT                   /transl_table="11"
FT                   /note="PFAM: plasmid maintenance system killer; KEGG:
FT                   bch:Bcen2424_3084 plasmid maintenance system killer"
FT                   /db_xref="GI:257091851"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="GeneID:8402331"
FT                   /translation="MIKSFQHKGLQAFFETGSKAGIQPHHSQKLLRLLARLDVAKVPED
FT                   MNLPGWRLHSLAGNLAGFHSVSVNGNWRMTFTFEDGDAVLVDYLDYH"
FT                   /protein_id="YP_003165492.1"
FT   misc_feature    249688..249963
FT                   /note="Plasmid maintenance system killer protein; Region:
FT                   Plasmid_killer; cl01422"
FT                   /db_xref="CDD:120640"
FT                   /locus_tag="CAP2UW1_0205"
FT   gene            249977..250291
FT                   /db_xref="GeneID:8402332"
FT                   /locus_tag="CAP2UW1_0206"
FT   CDS_pept        249977..250291
FT                   /locus_tag="CAP2UW1_0206"
FT                   /gene_family="HOG000265974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative plasmid maintenance system antidote
FT                   protein, XRE family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: addiction module antidote protein, HigA
FT                   family; KEGG: bcm:Bcenmc03_3101 putative plasmid
FT                   maintenance system antidote protein, XRE family"
FT                   /db_xref="GI:257091852"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="GeneID:8402332"
FT                   /translation="MNRMHAYPHPGEALREDVLPALGLSVTAAAAQLGVTRAALSRVLN
FT                   GRAAISPEMALRLEGWLGVENGGRADAWIAQQAAFDLWKARQAGAPTVRRAQVEIAPTV
FT                   "
FT                   /protein_id="YP_003165493.1"
FT   misc_feature    249995..250237
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="CAP2UW1_0206"
FT   gene            complement(250296..251546)
FT                   /db_xref="GeneID:8402333"
FT                   /locus_tag="CAP2UW1_0207"
FT   CDS_pept        complement(250296..251546)
FT                   /locus_tag="CAP2UW1_0207"
FT                   /gene_family="HOG000116001" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sus:Acid_6259 hypothetical protein"
FT                   /db_xref="GI:257091853"
FT                   /db_xref="GeneID:8402333"
FT                   /translation="MKQPDDLSAYYEELLEGRYDCVDRIVLNGYFPLGQQAISLEKEGN
FT                   CFVGGSFQALDQLADTLCDEHAIGRLAKVCDRWVYSSCLCFALTIEEQERSRFRYRYSV
FT                   YQIEYSRNLLFVRGTTLDAVFQGLIDRTRRLLDVPILRTLFGRKQRPRWRADRSHGVAR
FT                   IVDQSAYDLTVFKVHFGALTLKLYDKGARVLRAEAIAHNIKELRCGRSLEKLSIMLAKL
FT                   QHMAIDFLNAMQAAHVSFLPDGVLDSLIEPTERGNRRLSGVDLQKPRMRSVAEAILHLA
FT                   PNPDGFTVQELADEVRPSLPEVSRDAYTGRQAAYDLMKLRGKCLIERIAKTRRYRPQPT
FT                   GISILAGWLILREKVIKPVLAGAGTPHLGPPPKNIQALDQHYENLQRELRRTFDTLLIT
FT                   VAPGSNTNTNMFASTPA"
FT                   /protein_id="YP_003165494.1"
FT   gene            complement(252477..252550)
FT                   /note="tRNA-Thr3"
FT                   /db_xref="GeneID:8402334"
FT                   /locus_tag="CAP2UW1_R0004"
FT   tRNA            complement(252477..252550)
FT                   /db_xref="GeneID:8402334"
FT                   /locus_tag="CAP2UW1_R0004"
FT                   /product="tRNA-Thr"
FT   gene            252708..254501
FT                   /db_xref="GeneID:8402335"
FT                   /locus_tag="CAP2UW1_0208"
FT   CDS_pept        252708..254501
FT                   /locus_tag="CAP2UW1_0208"
FT                   /gene_family="HOG000220059" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: dar:Daro_0787 GGDEF"
FT                   /db_xref="GI:257091854"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="GeneID:8402335"
FT                   /translation="MPSLSNPSEIAREALRLLAARRMSPSPENYRALYYEIAGIADHVA
FT                   EAFPEQDLKALPASLPRATASQQRLAKRFEQALGGRNWEEVQAGVAELAKEIGREQDLP
FT                   WSELLGEFLRQWEGKQAGLTVARKREALERVLAGGSTNRELLFGRLQGLVKSWSLNAPV
FT                   ADEIPLVEPETLAAPSSAAVMAAEGGATPSAGTTSEPAAELRELFAYTLEAVITTQLGD
FT                   EPELAAEARDLAHKVRTTMSRAAMDGLLTAIKRFAFRLDILAEDRGELRAGLLNLLQLL
FT                   IQNVGELVVEDHWLKGQIDIVRDIVAQPLSLRSIGDAESRLREVIFKQSQLKHSLNEAK
FT                   EALKQMLAGFVDHLAEFADSTSDYHDKIEVCADRISKAEDINQLEDVLAEVIRETQIIQ
FT                   LNAQRSRDDLRNAKLRVEEADKRISELQAELDRASTLVRHDQLTGALNRRGLEEAFGKE
FT                   TARSRRRQSCLCVALLDIDNFKKLNDSLGHDAGDAALIHLATVIRETMRPQDTIARYGG
FT                   EEFIILLPDTSIEDAQTAIVRLQRELTRRIFLHNNDRQLITFSAGVTDFRAEDTQLSVT
FT                   KRADEAMYAAKQAGKNRVLVG"
FT                   /protein_id="YP_003165495.1"
FT   misc_feature    254019..254489
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0208"
FT   misc_feature    order(254130..254132,254259..254261)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0208"
FT   misc_feature    order(254145..254147,254154..254159,254169..254171,
FT                   254181..254183,254247..254249,254253..254264)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0208"
FT   misc_feature    order(254235..254237,254319..254321)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0208"
FT   gene            complement(254539..255339)
FT                   /db_xref="GeneID:8402336"
FT                   /locus_tag="CAP2UW1_0209"
FT   CDS_pept        complement(254539..255339)
FT                   /locus_tag="CAP2UW1_0209"
FT                   /gene_family="HOG000263839" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   dar:Daro_0656 UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="GI:257091855"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="GeneID:8402336"
FT                   /translation="MSETAGDPGRRFGGIARLYGAGALSRLQSAHVAVVGIGGVGSWAV
FT                   EGLARSAVGRITLVDLDMVAESNVNRQVHALEGEFGKAKVSAMAQRIQSINPACLVTEI
FT                   EDFVTPENVDTILAGHFDYVIDAIDQVRSKAAMIDWSKRRGVPLITAGAAGGQIDPTQI
FT                   RVADLALTIQDPLLARVRALLRKDYGFTREAKKKFGIPAVFSGEALRYPDRAIGCAEPR
FT                   ALSGLNCAGFGSSVCVTAPFGLLAAGEALRALAGGKSPVAEALA"
FT                   /protein_id="YP_003165496.1"
FT   misc_feature    complement(254614..255339)
FT                   /note="Dinucleotide-utilizing enzymes involved in
FT                   molybdopterin and thiamine biosynthesis family 1 [Coenzyme
FT                   metabolism]; Region: COG1179"
FT                   /db_xref="CDD:31372"
FT                   /locus_tag="CAP2UW1_0209"
FT   misc_feature    complement(254614..255285)
FT                   /note="Family of activating enzymes (E1) of ubiquitin-like
FT                   proteins related to the E.coli hypothetical protein ygdL.
FT                   The common reaction mechanism catalyzed by E1-like enzymes
FT                   begins with a nucleophilic attack of the C-terminal
FT                   carboxylate of the ubiquitin...; Region: YgdL_like;
FT                   cd00755"
FT                   /db_xref="CDD:30110"
FT                   /locus_tag="CAP2UW1_0209"
FT   misc_feature    complement(order(254941..254943,254959..254961,
FT                   255088..255090,255127..255129,255154..255156,
FT                   255160..255162,255220..255222,255226..255228,
FT                   255232..255234))
FT                   /note="putative ATP binding site; other site"
FT                   /db_xref="CDD:30110"
FT                   /locus_tag="CAP2UW1_0209"
FT   misc_feature    complement(order(254863..254865,254881..254886,
FT                   254938..254940,255220..255222))
FT                   /note="putative substrate interface; other site"
FT                   /db_xref="CDD:30110"
FT                   /locus_tag="CAP2UW1_0209"
FT   gene            complement(255336..256445)
FT                   /db_xref="GeneID:8402337"
FT                   /locus_tag="CAP2UW1_0210"
FT   CDS_pept        complement(255336..256445)
FT                   /locus_tag="CAP2UW1_0210"
FT                   /gene_family="HOG000133824" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metal dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; Hpt domain protein; KEGG: dar:Daro_0657
FT                   metal-dependent phosphohydrolase, HD subdomain:Hpt"
FT                   /db_xref="GI:257091856"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR008208"
FT                   /db_xref="GeneID:8402337"
FT                   /translation="MDRQMIVAPVAADRETLQDFIDSLRDYAPGIEGDIAHLRSTPADR
FT                   GAIGSLFRALHSIKGDATICRLDLAVAIVHPVESILDRVRQGELPFSEQIAEVILLTID
FT                   RLELAMAGLSAGDRLDGLHLVSLVEGLERLASAPTGQFEDCVAEVIEAVTGFRPVSATA
FT                   VSTRREAPGLRSTANSPTDDDLRFFHTLADQFEARSPIFKGRTLRLLRLALETNRLAGE
FT                   TIDPLQLEAAVYMHDIGMMFLPESAWLKTSALTAEEKAMLRTHPAYAAGLLARMSGWAG
FT                   AAEMVAQHHETPDGKGYPAAHKAAQICPGAKLLAIVDAYEAVMLKHGSHGRTRSLLRAI
FT                   AEINACDTQFAPEWIEPFNRVIRRAADAR"
FT                   /protein_id="YP_003165497.1"
FT   misc_feature    complement(256125..256406)
FT                   /note="Histidine Phosphotransfer domain, involved in
FT                   signalling through a two part component systems in which an
FT                   autophosphorylating histidine protein kinase serves as a
FT                   phosphoryl donor to a response regulator protein; the
FT                   response regulator protein is...; Region: HPT; cl00086"
FT                   /db_xref="CDD:153503"
FT                   /locus_tag="CAP2UW1_0210"
FT   misc_feature    complement(255417..255773)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cd00077"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="CAP2UW1_0210"
FT   misc_feature    complement(order(255492..255494,255735..255740))
FT                   /note="Zn2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="CAP2UW1_0210"
FT   misc_feature    complement(255735..255737)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="CAP2UW1_0210"
FT   gene            256659..257003
FT                   /db_xref="GeneID:8402338"
FT                   /locus_tag="CAP2UW1_0211"
FT   CDS_pept        256659..257003
FT                   /locus_tag="CAP2UW1_0211"
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   dar:Daro_3469 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="GI:257091857"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="GeneID:8402338"
FT                   /translation="MPIVTTPSGLQIEEIIVGSGPTASVGQHVIVHYTGWLADGKKFDS
FT                   SKDRNEPFRFPLDGRHVIAGWEEGVPGMSVGGIRKLTIPADLAYGARGAGKMIPPNAKL
FT                   VFEIELLDIA"
FT                   /protein_id="YP_003165498.1"
FT   misc_feature    256710..256991
FT                   /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
FT                   Region: FKBP_C; cl11587"
FT                   /db_xref="CDD:187101"
FT                   /locus_tag="CAP2UW1_0211"
FT   gene            257007..257924
FT                   /db_xref="GeneID:8402339"
FT                   /locus_tag="CAP2UW1_0212"
FT   CDS_pept        257007..257924
FT                   /locus_tag="CAP2UW1_0212"
FT                   /gene_family="HOG000044956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pseudouridine synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; KEGG: eba:ebA4056 propable 16S pseudouridylate
FT                   synthase"
FT                   /db_xref="GI:257091858"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="GeneID:8402339"
FT                   /translation="MAERPRKTLLSRPPPAADGVATTGTGHPPHPARGRLVRAPAVSPR
FT                   VVPGSPATKVAATVVSAPPGGVRISKLMAERGLCSRRDADDYIARGWVFVDGRRVSELG
FT                   TRADPGAAITLDTAAQTQQRKQMTILLHKPVGYVSGQPEPGCTPAVTLIQPERQFRTPD
FT                   TPVFHPSCLRGLAPAGRLDIDSTGLLVLTQDGRVARQLIGEESTVEKEYLVRVDGRLAD
FT                   KDLALLNHGLSLDGRQLKPARVEWLNDDQLRFVLREGRKRQIRRMCELVGLRVTGLKRV
FT                   RIGAVRLADLPLGQWRFLRPDEVF"
FT                   /protein_id="YP_003165499.1"
FT   misc_feature    257202..257921
FT                   /note="16S rRNA uridine-516 pseudouridylate synthase and
FT                   related pseudouridylate synthases [Translation, ribosomal
FT                   structure and biogenesis]; Region: RsuA; COG1187"
FT                   /db_xref="CDD:31380"
FT                   /locus_tag="CAP2UW1_0212"
FT   misc_feature    257205..>257354
FT                   /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
FT                   domain surface is populated by conserved, charged residues
FT                   that define a likely RNA-binding site;  Found in stress
FT                   proteins, ribosomal proteins and tRNA synthetases; This may
FT                   imply a hitherto unrecognized...; Region: S4; cd00165"
FT                   /db_xref="CDD:29105"
FT                   /locus_tag="CAP2UW1_0212"
FT   misc_feature    order(257208..257210,257244..257246,257250..257255,
FT                   257259..257264,257271..257276,257280..257282,
FT                   257301..257324,257328..257330)
FT                   /note="RNA binding surface; other site"
FT                   /db_xref="CDD:29105"
FT                   /locus_tag="CAP2UW1_0212"
FT   misc_feature    257388..257921
FT                   /note="PseudoU_synth:  Pseudouridine synthases catalyze the
FT                   isomerization of specific uridines in an RNA molecule to
FT                   pseudouridines (5-ribosyluracil, psi). Pseudouridine
FT                   synthases contains the RsuA/RluD, TruA, TruB and TruD
FT                   families.  This group consists of...; Region:
FT                   PseudoU_synth; cl00130"
FT                   /db_xref="CDD:185798"
FT                   /locus_tag="CAP2UW1_0212"
FT   misc_feature    order(257541..257552,257799..257801)
FT                   /note="active site"
FT                   /db_xref="CDD:73252"
FT                   /locus_tag="CAP2UW1_0212"
FT   gene            complement(257965..259005)
FT                   /db_xref="GeneID:8402340"
FT                   /locus_tag="CAP2UW1_0213"
FT   CDS_pept        complement(257965..259005)
FT                   /locus_tag="CAP2UW1_0213"
FT                   /gene_family="HOG000284356" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.1.1.158"
FT                   /note="KEGG: dar:Daro_0044 UDP-N-acetylmuramate
FT                   dehydrogenase; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="GI:257091859"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="GeneID:8402340"
FT                   /translation="MNGEKLPHFVERDADLGGRTTLALPGRAAFYAEIKSVEQLAQLAG
FT                   KSALRRFVLGAGSNLVLTGDFDGLVLHMAIGGRELIGEDDDAWYVRGGAGEDWHAFVEW
FT                   TLAKGCWPGLENLALIPGTVGAAPIQNIGAYGLELADRFQSLEACDMLTGRTVRLDRDA
FT                   CRFAYRDSVFKQQGWHLDARLVITRVTFRLPKAWQPLASYADLAAELDQRQLGRPNARQ
FT                   IADAVIAVRRRKLPDPASVPNAGSFFHNPLVEANVGERLAAAHPDLPSYLQADGRVKLA
FT                   AGWLIERCGWKGRTLGQAGMYEKQALVLVNRGGATGAEVLALARAVQDAVRERFGVALT
FT                   PEPVFL"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165500.1"
FT   misc_feature    complement(257968..258978)
FT                   /note="UDP-N-acetylenolpyruvoylglucosamine reductase;
FT                   Provisional; Region: murB; PRK00046"
FT                   /db_xref="CDD:178820"
FT                   /locus_tag="CAP2UW1_0213"
FT   misc_feature    complement(258526..258924)
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="CAP2UW1_0213"
FT   misc_feature    complement(257968..258342)
FT                   /note="UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   C-terminal domain; Region: MurB_C; pfam02873"
FT                   /db_xref="CDD:111727"
FT                   /locus_tag="CAP2UW1_0213"
FT   gene            complement(259025..262741)
FT                   /db_xref="GeneID:8402341"
FT                   /locus_tag="CAP2UW1_0214"
FT   CDS_pept        complement(259025..262741)
FT                   /locus_tag="CAP2UW1_0214"
FT                   /gene_family="HOG000251409" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionine synthase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; homocysteine S-methyltransferase; Methionine
FT                   synthase B12-binding module cap domain protein; Vitamin B12
FT                   dependent methionine synthase activation region; cobalamin
FT                   B12-binding domain protein; KEGG: eba:ebA3184 B12-dependent
FT                   methionine synthase"
FT                   /db_xref="GI:257091860"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="GeneID:8402341"
FT                   /translation="MQLDRTAELKARLEHDILVLDGAMGTMIQRRGLREADYRGTRFAA
FT                   HPHDLKGNNDLLLLTRPDIIRAIHAEYLAAGADIIETNTFNSTSASQADYRLEAIVYEL
FT                   NVAGAQLARAVCDEFTAGNPAKPRFVAGVLGPTSRTASISPDVNDPGYRNTSFDELVDT
FT                   YAEAIRGLCDGGADILLVETVFDTLNAKAALFAIERHFDEVGRRWPVMISGTITDASGR
FT                   TLSGQTAEAFWNSLNHIRPLCFGLNCALGAADLRQYVEELSHLCECFVSAHPNAGLPNA
FT                   FGGYDETPEQLAAEIGDWARKGFVNIVGGCCGTSPAHIAAIAASVAGVQPRVIPERERK
FT                   LRLSGLEPFNVGRDSLFVNVGERTNVTGSRAFARMILEGRFDDALAVARQQVENGAQVI
FT                   DINMDEAMLDSQAAMDRFLKLIASEPDISRVPIMLDSSKWEVIEAGLKCIQGKGIVNSI
FT                   SMKEGEAEFLRQARLARRYGAAVVVMAFDETGQADTYTRKTEICARAYRLLTEQAAFPP
FT                   EDIIFDPNIFAIATGIEEHNNYAVDFIEACAWIRAHLPGAQISGGVSNVSFSFRGNDAV
FT                   REAIHTVFLYHAVKAGLSMGIVNAGMLGVYDDLDPALRDKVEDVVLNRRPDAGEALVEF
FT                   AQTVKEGRSREGGMGGPDLAWRDFEVEARLTHALVKGINDFVVADTEECRATVESAGKP
FT                   PLSVIEGPLMNGMNVVGDLFGAGKMFLPQVVKSARVMKQAVAHLIPYIEAEKLRTGVSS
FT                   KGKIVIATVKGDVHDIGKNIVGVVLGCNGYDVVDLGVMVGCDKILHAAREHGAQAIGLS
FT                   GLITPSLEEMSHVAAEMERLGFATGTDGSPPVPLLIGGATTSRAHTAIKIAPNYSGPVV
FT                   YVPDASRAVGVVTKLLSIDNADAFKAGLAADYEKLRAQHAGKKGTTLLALEAARDNRFV
FT                   WNGEATYRPSAPKRPGLHVLRAIDLATLAGFIDWAPFFQTWDLAGSYPKILDDPLVGAT
FT                   ARAVFSDAQAMLDKVIAENWLSANAVFGIFPANSVGDDIEIYADETRAKTLMTWHNLRQ
FT                   QHERPAGKPHYCLSDFVAERGTPDWIGAFAVSAGFGIEEKLAEFAAAHDDYHAIMLKAI
FT                   ADRLAEACAEWLHARVRREYWAYAGDEGLDPEALIREAYRGIRPAPGYPACPDHTAKGA
FT                   LFAMLDAPRNAGIELTESFAMTPAAAVSGFYLAHPQARYFAISKIAGDQLADWAQRAGF
FT                   SVPEAQRWLAPLL"
FT                   /protein_id="YP_003165501.1"
FT   misc_feature    complement(259028..262741)
FT                   /note="B12-dependent methionine synthase; Provisional;
FT                   Region: metH; PRK09490"
FT                   /db_xref="CDD:181903"
FT                   /locus_tag="CAP2UW1_0214"
FT   misc_feature    complement(261794..262702)
FT                   /note="Homocysteine/selenocysteine methylase
FT                   (S-methylmethionine-dependent) [Amino acid transport and
FT                   metabolism]; Region: MHT1; cl14105"
FT                   /db_xref="CDD:187229"
FT                   /locus_tag="CAP2UW1_0214"
FT   misc_feature    complement(260903..261673)
FT                   /note="MeTr subgroup of pterin binding enzymes. This family
FT                   includes cobalamin-dependent methyltransferases such as
FT                   methyltetrahydrofolate, corrinoid iron-sulfur protein
FT                   methyltransferase (MeTr) and methionine synthase (MetH).
FT                   Cobalamin-dependent...; Region: MeTr; cd00740"
FT                   /db_xref="CDD:29546"
FT                   /locus_tag="CAP2UW1_0214"
FT   misc_feature    complement(order(260945..260947,260951..260953,
FT                   261044..261046,261056..261058,261173..261175,
FT                   261290..261292,261368..261370,261374..261376,
FT                   261437..261439,261647..261649))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:29546"
FT                   /locus_tag="CAP2UW1_0214"
FT   misc_feature    complement(260081..260761)
FT                   /note="B12 binding domain of methionine synthase. This
FT                   domain binds methylcobalamin, which it uses as an
FT                   intermediate methyl carrier from methyltetrahydrofolate
FT                   (CH3H4folate) to homocysteine (Hcy); Region:
FT                   methionine_synthase_B12_BD; cd02069"
FT                   /db_xref="CDD:30207"
FT                   /locus_tag="CAP2UW1_0214"
FT   misc_feature    complement(order(260105..260107,260114..260116,
FT                   260123..260125,260189..260191,260294..260302,
FT                   260306..260314,260423..260425,260432..260452,
FT                   260570..260572,260579..260581,260630..260632,
FT                   260642..260644))
FT                   /note="B12 binding site; other site"
FT                   /db_xref="CDD:30207"
FT                   /locus_tag="CAP2UW1_0214"
FT   misc_feature    complement(260441..260443)
FT                   /note="cobalt ligand; other site"
FT                   /db_xref="CDD:30207"
FT                   /locus_tag="CAP2UW1_0214"
FT   misc_feature    complement(259121..259528)
FT                   /note="Vitamin B12 dependent methionine synthase,
FT                   activation domain; Region: Met_synt_B12; pfam02965"
FT                   /db_xref="CDD:111813"
FT                   /locus_tag="CAP2UW1_0214"
FT   gene            263061..264239
FT                   /db_xref="GeneID:8402342"
FT                   /locus_tag="CAP2UW1_0215"
FT   CDS_pept        263061..264239
FT                   /locus_tag="CAP2UW1_0215"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: swd:Swoo_2828 diguanylate
FT                   cyclase"
FT                   /db_xref="GI:257091861"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="GeneID:8402342"
FT                   /translation="MTLPSPATSLDDNVQLARIRIFFGHASGNMASILVGAILIAVVLH
FT                   SGGVSLPTLGVWGLFVCAASAGVLLVERRVKKTGVTAGNCQRLVNLRIGLGAGIALSYG
FT                   IVGFLLPGTAPAQDTFLFIIVSTVVTVAALGYAVMPRYYLTLNVVSLLPLTGHFAQQYL
FT                   AHADSYYLLLIAVAIMWQAIVLAKARQVSATAIGAIVLNERLQQEIEENRRTREAIRHM
FT                   ALHDDLTALGNRRYFEETIARTLSIASRDQGKVGLLAIDLDNFKPINDRYGHTAGDRVL
FT                   KAVAARLLSSIRAADFCARMGGDEFAIIVASVHAESDVADVASKLRLALAEPFQLDAIV
FT                   VRISASVGFAVYPDDGIGASALWSVADRRMYRAKASRVSEQPLAMPLHELGE"
FT                   /protein_id="YP_003165502.1"
FT   misc_feature    263730..264191
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0215"
FT   misc_feature    order(263841..263843,263970..263972)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0215"
FT   misc_feature    order(263856..263858,263865..263870,263880..263882,
FT                   263892..263894,263958..263960,263964..263975)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0215"
FT   misc_feature    order(263946..263948,264033..264035)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0215"
FT   gene            264330..264932
FT                   /db_xref="GeneID:8402343"
FT                   /locus_tag="CAP2UW1_0216"
FT   CDS_pept        264330..264932
FT                   /locus_tag="CAP2UW1_0216"
FT                   /gene_family="HOG000112970" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: rfr:Rfer_0614 multiple antibiotic resistance
FT                   (MarC)-related proteins"
FT                   /db_xref="GI:257091862"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="GeneID:8402343"
FT                   /translation="MNYTFASATILLLLITDPIGNIPIFANALRHVAPERRPWVILREV
FT                   LIAFVLLLTFMFVGEGFLRLMNLSELSLQIGGGVILFLIALRMIFPPPNPDTPDTTGEP
FT                   LIVPLAIPAIAGPSALATVLLLVSQAPDRRLEWIAALCITMAVSAVVLVLAERIQRVVG
FT                   DRFVVALERLMGLVLVAMSIEMMLRGIKTFATQITRM"
FT                   /protein_id="YP_003165503.1"
FT   misc_feature    264348..264908
FT                   /note="MarC family integral membrane protein; Region: MarC;
FT                   cl00919"
FT                   /db_xref="CDD:186259"
FT                   /locus_tag="CAP2UW1_0216"
FT   gene            complement(265070..267037)
FT                   /db_xref="GeneID:8402344"
FT                   /locus_tag="CAP2UW1_0217"
FT   CDS_pept        complement(265070..267037)
FT                   /locus_tag="CAP2UW1_0217"
FT                   /gene_family="HOG000058376" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coenzyme A transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: coenzyme A transferase; KEGG: mex:Mext_2071
FT                   coenzyme A transferase"
FT                   /db_xref="GI:257091863"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="GeneID:8402344"
FT                   /translation="MRSKIVTADEAIALIRDGDTLASTGFVQTGFAEALLSALERRFLT
FT                   TGRPRNLALFAAAGQGDGKTLGLNHLGHEGLLRRVVAGHWGRMPTVAKLALDNRIQAYN
FT                   LPQGIICQLFRDLASGKPGSFSKVGLHTFVDPRYGGGRVNAATTKDIVSLVEVEGEEWL
FT                   FYKVGTVNVAFVRGTTADTFGNITMEREALTLNNLAMAMAAKNSNGIVIAQVERIAERS
FT                   GLPPRQVKIPGILVDCVVVAEPAQHMQTLATQYNAAYAGEFRVPAASLVSTPLTERKII
FT                   ARRAAFELPPNGIINLGVGMPEGVAAVANEERISHLLTLTVESGLIGGIPSSGGNFGTG
FT                   VNMDAVIDENQQFDFYDGGGLDMACLGMAECDAAGNVDVSRFGGRLTGAGGFINISQNA
FT                   RLVVFVGTFTGSGLKVDVDNGKLRILQEGVQKKFVRQVEQITFNGQYAYDRGKPVYYVT
FT                   ERCVFRRVRRGLALIEVAPGIDVGRDILAHMDFEPIIGEYGEMDARIFSANPMGLEAEL
FT                   LNLSLPERVIYDPERNILFLNFEGMHVRGSDDVQAIWDICELRCRAAGQRVGVIINYDR
FT                   FRINQDMYDAYAEMDRYFLANYFSQITRYATSAFLRAKLGEAFSARSIAPHVFERREEA
FT                   QAFLAGRSGDYGPQPSSGLP"
FT                   /protein_id="YP_003165504.1"
FT   misc_feature    complement(265490..267037)
FT                   /note="Acyl CoA:acetate/3-ketoacid CoA transferase [Lipid
FT                   metabolism]; Region: COG4670"
FT                   /db_xref="CDD:34288"
FT                   /locus_tag="CAP2UW1_0217"
FT   misc_feature    complement(266300..267037)
FT                   /note="Coenzyme A transferase; Region: CoA_trans; cl00773"
FT                   /db_xref="CDD:186182"
FT                   /locus_tag="CAP2UW1_0217"
FT   misc_feature    complement(265529..266227)
FT                   /note="Coenzyme A transferase; Region: CoA_trans; cl00773"
FT                   /db_xref="CDD:186182"
FT                   /locus_tag="CAP2UW1_0217"
FT   gene            complement(267806..269260)
FT                   /db_xref="GeneID:8402345"
FT                   /locus_tag="CAP2UW1_0218"
FT   CDS_pept        complement(267806..269260)
FT                   /locus_tag="CAP2UW1_0218"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Sporulation domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Sporulation domain protein"
FT                   /db_xref="GI:257091864"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="GeneID:8402345"
FT                   /translation="MTKTARLAVPNNAQAENEITMQASASLETLETEIPAIEPKMAGLL
FT                   EFTRANDSRLTPKEINAQLDLVLRDYDDLTARYAENNRLIDTALAELRQSGGAVSSQVH
FT                   RLDADLQQQRMSLAAHATATEQRIEAVAEDARGHLAETEQRWETRLASDNARIGADLTR
FT                   LGAGIGSLHGLFAAQERIIAEQRVRLDQFDLTYELLDSVTRGNKSRIEAVREQAAKQHA
FT                   IVEARLEGLSALQREHHAEFQTLQGLVGVLQSETQRLDAAIGELATAQADHRSATRDTF
FT                   KWTHRAIAALLLLTISGFVLVKWVPAFAPASSESAIAKNDARITEVSSQMASLSAAEAA
FT                   RKTSDALQQGRLEQVSDKVSGLEKSLGELRTALRKIGVPSGGAAVVHDSQWLLRQHPKA
FT                   YTVQLVMSPSRDDMARFIDRNMEHLTLNSLAFSATEHQQREHYNLFFGVFDTIAQARAA
FT                   IAALPAELRVNQPWVRQLQSVQDSLR"
FT                   /protein_id="YP_003165505.1"
FT   misc_feature    complement(<268424..>269077)
FT                   /note="chromosome segregation protein SMC, common bacterial
FT                   type; Region: SMC_prok_B; TIGR02168"
FT                   /db_xref="CDD:162739"
FT                   /locus_tag="CAP2UW1_0218"
FT   misc_feature    complement(267812..>268288)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: DamX; COG3266"
FT                   /db_xref="CDD:33077"
FT                   /locus_tag="CAP2UW1_0218"
FT   gene            complement(269494..269808)
FT                   /db_xref="GeneID:8402346"
FT                   /locus_tag="CAP2UW1_0219"
FT   CDS_pept        complement(269494..269808)
FT                   /locus_tag="CAP2UW1_0219"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091865"
FT                   /db_xref="GeneID:8402346"
FT                   /translation="MRIGSLRTPQAAGTIELAGHLDESIAALPDTASGISTACDATGLS
FT                   TTGQDGGQENTGHECAFPVTATSYESFALGQRYRKWGGHQKLLRCTHPAVRLGRRTLAT
FT                   "
FT                   /protein_id="YP_003165506.1"
FT   gene            269910..270920
FT                   /db_xref="GeneID:8402347"
FT                   /locus_tag="CAP2UW1_0220"
FT   CDS_pept        269910..270920
FT                   /locus_tag="CAP2UW1_0220"
FT                   /gene_family="HOG000260057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein family 1; KEGG: cvi:CV_1832 sulfate transport
FT                   system sulfate-binding protein"
FT                   /db_xref="GI:257091866"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:8402347"
FT                   /translation="MNVQESLAGLLVGALLLGSASAAEITILNVSYDPTRELYQDFNAA
FT                   FGKYWQAKTGDTLRVKASHGGSGKQARSVIDGIDADVVTLALAFDIDAIADRGIVPLDW
FT                   QKRLPSNAAPYTSTIVFLVRKGNPKAIRDWNDLVKPGVSIITPNPKTSGGARWNYLAAW
FT                   AYALKQPGGSETRAREFVGQIYGNVKVLDSGARGSTTTFVERGIGDVLIAWENEAYLAI
FT                   KELGPDKFEIVTPSLSILAEPPVSVVDRVVDKRATRKVAQAYLDYLYSPEGQEIAARHY
FT                   YRPRDAKVSAKYAGQFGKVNLVTIDDTFGGWRYAQKTHFSDGGIFDQIYVPGGKR"
FT                   /protein_id="YP_003165507.1"
FT   sig_peptide     269910..269978
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_0220"
FT   misc_feature    269979..270899
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="CAP2UW1_0220"
FT   gene            271105..271941
FT                   /db_xref="GeneID:8402348"
FT                   /locus_tag="CAP2UW1_0221"
FT   CDS_pept        271105..271941
FT                   /locus_tag="CAP2UW1_0221"
FT                   /gene_family="HOG000263698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysT; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azo:azo1335 sulfate
FT                   transport system permease protein probably"
FT                   /db_xref="GI:257091867"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="GeneID:8402348"
FT                   /translation="MTSVKRYSPLPGFRLAMGYTLVYLTLIVLIPLAAVGTKTLTMGWE
FT                   AFWAAVSSPRVVASYQLSFGASLLAAAINVVFGLIFAWVLVRYRFPGKGLIDSLVDLPF
FT                   ALPTAVAGIALATIYSENGPVGKLLEPWGIEIAYTPNGVLLALVFIGLPFVVRTVQPVL
FT                   GDLEKEVEEAAAGLGASRWQTFLRIILPHIAPALLTGFAMAFARAVGEYGSVIFIAGNV
FT                   PMVSEITPLLIITKLEQYDYAGATAVASVMLVFSFVLLLIINGLQGWMQNRHAKGA"
FT                   /protein_id="YP_003165508.1"
FT   misc_feature    271291..271842
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0221"
FT   misc_feature    order(271330..271335,271342..271347,271360..271362,
FT                   271390..271401,271405..271434,271441..271446,
FT                   271450..271452,271546..271551,271558..271560,
FT                   271564..271566,271573..271578,271582..271584,
FT                   271594..271599,271606..271608,271657..271659,
FT                   271699..271704,271711..271713,271732..271743,
FT                   271750..271755,271792..271797,271825..271830,
FT                   271837..271842)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0221"
FT   misc_feature    order(271408..271452,271732..271749)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0221"
FT   misc_feature    order(271450..271452,271531..271533,271750..271752,
FT                   271786..271788,271795..271797,271825..271827)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0221"
FT   misc_feature    order(271609..271647,271663..271668,271678..271680)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0221"
FT   gene            271943..272836
FT                   /db_xref="GeneID:8402349"
FT                   /locus_tag="CAP2UW1_0222"
FT   CDS_pept        271943..272836
FT                   /locus_tag="CAP2UW1_0222"
FT                   /gene_family="HOG000263697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysW; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mms:mma_0813 sulfate ABC
FT                   transporter, permease protein"
FT                   /db_xref="GI:257091868"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="GeneID:8402349"
FT                   /translation="MSATIALHAGSLEHAETASTREPAWVRVVLISIALTFFAVFLLLP
FT                   LGTVFAEGLRKGWAAYVAALVNDDAWDAIKLTLITAAIAVPLNLVFGVAAAWSIAKFEF
FT                   PGKRLLITFIDLPFSVSPVISGLIYVLLFGAQGWFGPWLQEHDIRIIFAVPGIVLATIF
FT                   VTFPFVARELIPLMEAQGSEEEEAAVVLGASGWQVFWYTTLPNIKWGLLYGVILCNARA
FT                   MGEFGAVSVVSGHIRGQTNTMPLYVEILYNEYNYAAAFAVASLLALLAIVTLALKTLVE
FT                   RQTRRQLQEIIEPSGE"
FT                   /protein_id="YP_003165509.1"
FT   misc_feature    272195..272710
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0222"
FT   misc_feature    order(272210..272215,272222..272227,272240..272242,
FT                   272270..272281,272285..272314,272321..272326,
FT                   272330..272332,272426..272431,272438..272440,
FT                   272444..272446,272453..272458,272462..272464,
FT                   272474..272479,272486..272488,272537..272539,
FT                   272579..272584,272591..272593,272612..272623,
FT                   272630..272635,272672..272677,272705..272710)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0222"
FT   misc_feature    order(272288..272332,272612..272629)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0222"
FT   misc_feature    order(272330..272332,272411..272413,272630..272632,
FT                   272666..272668,272675..272677,272705..272707)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0222"
FT   misc_feature    order(272489..272527,272543..272548,272558..272560)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="CAP2UW1_0222"
FT   gene            272840..273907
FT                   /db_xref="GeneID:8402350"
FT                   /locus_tag="CAP2UW1_0223"
FT   CDS_pept        272840..273907
FT                   /locus_tag="CAP2UW1_0223"
FT                   /codon_start="1"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: azo:azo1333 putative sulfate transport
FT                   ATP-binding protein; TIGRFAM: sulfate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="GI:257091869"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="GeneID:8402350"
FT                   /translation="MSIAIRNISKQFGAFKALDDVSIDVPSGELVALLGPSGCGKTTLL
FT                   RIIAGLDFADSGQIVLDGDDASARHVRERHVGFVFQHYALFRHMSIADNVAFGLRVKPR
FT                   RERLAEADIKRRVKRLLELVQLDWLADRYPSQLSGGQRQRIALARALAVDPKVLLLDEP
FT                   FGALDAKVRKELRRWLRQLHDEIHVTSVFVTHDQEEALEVSDRVVVINKGKVEQIGTPE
FT                   SVYDHPATPFVANFLGSVNLFHGRVEDGHLHVGNDALALGASEGSDGKAVAFVRPHEFD
FT                   LVPGWDEQGALAARIVRVVSVGPSAQIELAHGDGKLIEVSLGRDAFRLLGLSEGDRVSL
FT                   RPRHIRVFPTDALAA"
FT                   /protein_id="YP_003165510.1"
FT   misc_feature    272840..273886
FT                   /note="ABC-type sulfate/molybdate transport systems, ATPase
FT                   component [Inorganic ion transport and metabolism]; Region:
FT                   CysA; COG1118"
FT                   /db_xref="CDD:31315"
FT                   /locus_tag="CAP2UW1_0223"
FT   misc_feature    272840..273556
FT                   /note="Part of the ABC transporter complex cysAWTP involved
FT                   in sulfate import.  Responsible for energy coupling to the
FT                   transport system.  The complex is composed of two
FT                   ATP-binding proteins (cysA), two transmembrane proteins
FT                   (cysT and cysW), and a solute...; Region:
FT                   ABC_CysA_sulfate_importer; cd03296"
FT                   /db_xref="CDD:73055"
FT                   /locus_tag="CAP2UW1_0223"
FT   misc_feature    272942..272965
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73055"
FT                   /locus_tag="CAP2UW1_0223"
FT   misc_feature    order(272951..272956,272960..272968,273080..273082,
FT                   273320..273325,273422..273424)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73055"
FT                   /locus_tag="CAP2UW1_0223"
FT   misc_feature    273071..273082
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73055"
FT                   /locus_tag="CAP2UW1_0223"
FT   misc_feature    273248..273277
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73055"
FT                   /locus_tag="CAP2UW1_0223"
FT   misc_feature    273308..273325
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73055"
FT                   /locus_tag="CAP2UW1_0223"
FT   misc_feature    273332..273343
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73055"
FT                   /locus_tag="CAP2UW1_0223"
FT   misc_feature    273410..273430
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73055"
FT                   /locus_tag="CAP2UW1_0223"
FT   gene            273917..274852
FT                   /db_xref="GeneID:8402351"
FT                   /locus_tag="CAP2UW1_0224"
FT   CDS_pept        273917..274852
FT                   /locus_tag="CAP2UW1_0224"
FT                   /gene_family="HOG000260068" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: dar:Daro_2129 transcriptional
FT                   regulator CysB-like protein"
FT                   /db_xref="GI:257091870"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:8402351"
FT                   /translation="MNFQQLRIIRETLRQDFNLTAVASALYTSQPGVSKHIKDLEDELG
FT                   IEIFVRRGKRLLGLTEPGKELAEVVDRILLGTQNLRRIADQFASRETGHFVVATTHTQA
FT                   RYALPQIIKWFKTDYPRVHLALHQGSPVDIAEKLVSGEADVGIATERLDQVPELETFPF
FT                   YRWHHALIVPHGHPLLQVDKLTLEVIGEYPIITYHEGFTGRTHIDKAFADAGVVPDIVL
FT                   SAIDADVIKTYVELELGVGIVASMAYDACKDRNLTLIAVPHLFPESTTRLAVRRGTYLR
FT                   SYALAFIEKVCPDIGEENLKAAIQKQNGNE"
FT                   /protein_id="YP_003165511.1"
FT   misc_feature    273917..274849
FT                   /note="transcriptional regulator CysB-like protein;
FT                   Reviewed; Region: PRK12684"
FT                   /db_xref="CDD:183681"
FT                   /locus_tag="CAP2UW1_0224"
FT   misc_feature    273923..274108
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="CAP2UW1_0224"
FT   misc_feature    274196..274783
FT                   /note="The C-terminal substrate domain of LysR-type
FT                   transcriptional regulators CysB-like contains type 2
FT                   periplasmic binding fold; Region: PBP2_CysB_like; cd08413"
FT                   /db_xref="CDD:176105"
FT                   /locus_tag="CAP2UW1_0224"
FT   misc_feature    order(274214..274216,274220..274225,274358..274366,
FT                   274412..274414,274520..274522)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:176105"
FT                   /locus_tag="CAP2UW1_0224"
FT   misc_feature    order(274217..274219,274226..274231,274238..274243,
FT                   274250..274252,274262..274264,274283..274303,
FT                   274313..274315,274577..274594,274598..274603,
FT                   274610..274615,274622..274624,274751..274762,
FT                   274766..274771)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176105"
FT                   /locus_tag="CAP2UW1_0224"
FT   gene            275159..275461
FT                   /db_xref="GeneID:8402352"
FT                   /locus_tag="CAP2UW1_0225"
FT   CDS_pept        275159..275461
FT                   /locus_tag="CAP2UW1_0225"
FT                   /gene_family="HOG000229187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpc:Cpar_0602 hypothetical protein"
FT                   /db_xref="GI:257091871"
FT                   /db_xref="GeneID:8402352"
FT                   /translation="MEKRRAHYDLGQVKAVVMYRGIDSFTSTALLGLFSMGLSEADGVS
FT                   IVLGLRRDMLFKSMTTHADSRVWQDVYHAPCPNGKTAYVKVTLQDGAVVIQFKEL"
FT                   /protein_id="YP_003165512.1"
FT   gene            275463..275873
FT                   /db_xref="GeneID:8402353"
FT                   /locus_tag="CAP2UW1_0226"
FT   CDS_pept        275463..275873
FT                   /locus_tag="CAP2UW1_0226"
FT                   /gene_family="HOG000151625" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   ypi:YpsIP31758_0889 putative transcriptional regulator"
FT                   /db_xref="GI:257091872"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:8402353"
FT                   /translation="MRNPAYCLQCDDGSVLQHGAQDMMITIDGMSQTVPAVVGWHCPTC
FT                   GTCEFDDGEGKRFSATLAALRQLANAQRAASLRAIRKKLGLRQADAGRLFGGGASAFSE
FT                   YERGKTQPHKSTVLLLKLLDRHPELLEELRGT"
FT                   /protein_id="YP_003165513.1"
FT   misc_feature    275481..275864
FT                   /note="putative zinc finger/helix-turn-helix protein, YgiT
FT                   family; Region: CxxCG_CxxCG_HTH; TIGR03830"
FT                   /db_xref="CDD:163542"
FT                   /locus_tag="CAP2UW1_0226"
FT   misc_feature    275481..275618
FT                   /note="YgiT-type zinc finger domain; Region: YgiT_finger;
FT                   TIGR03831"
FT                   /db_xref="CDD:163543"
FT                   /locus_tag="CAP2UW1_0226"
FT   misc_feature    275700..275852
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="CAP2UW1_0226"
FT   gene            complement(276025..276252)
FT                   /db_xref="GeneID:8402354"
FT                   /locus_tag="CAP2UW1_0227"
FT   CDS_pept        complement(276025..276252)
FT                   /locus_tag="CAP2UW1_0227"
FT                   /gene_family="HOG000280698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_3342 hypothetical protein"
FT                   /db_xref="GI:257091873"
FT                   /db_xref="GeneID:8402354"
FT                   /translation="MTTDRAVRIMAGSFILISLALGVPESPLFVSKYFLWFTAFVGANL
FT                   LQSGFTCFCPAESVMVKLGMKRGDEASCGR"
FT                   /protein_id="YP_003165514.1"
FT   misc_feature    complement(276073..276249)
FT                   /note="Protein of unknown function (DUF2892); Region:
FT                   DUF2892; pfam11127"
FT                   /db_xref="CDD:151571"
FT                   /locus_tag="CAP2UW1_0227"
FT   gene            complement(276249..279455)
FT                   /db_xref="GeneID:8402355"
FT                   /locus_tag="CAP2UW1_0228"
FT   CDS_pept        complement(276249..279455)
FT                   /locus_tag="CAP2UW1_0228"
FT                   /gene_family="HOG000280649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acriflavin resistance protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   dar:Daro_3343 acriflavin resistance protein"
FT                   /db_xref="GI:257091874"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="GeneID:8402355"
FT                   /translation="MGVSGRIARLFASSQMTPLLALVALLMGVFATLVTPREEEPQIDV
FT                   TMADVLIPFTGASVRDVENLVATPAEQVLSRMSGIEHVYSVSRPGMAIVTVQFAVGVKY
FT                   NDAVVRLYDTVHSHRDWLAPNLGVLEPTIKPKGIDDVPIVSLTFWTSDPTRSAFDLQQV
FT                   ARAAEIDLKRVKGTRDVSTLGGPDHVLRVLMDSERMNAFAVTPQDLAAALRVGNALQSS
FT                   GSLVAGNHEVLVQTGTYLESAADVRQLVVAVRGSADERKPVFMSDVARVEDGPDQPRRY
FT                   VWLGNREGEFPAVTVQVSKKPGVNAADVADALIARVATLKGTLIPEGVEVTVTRNYGQT
FT                   ATDKAQKLIGKLVFATAFVVLLVFFALGRREALIVGVAVSLTLAATLFASWAWGFTLNR
FT                   VSLFALIFSIGILVDDAIVVVENIHRWQALQPGTPLIEIIPLAVDEVGGPTILATFTVI
FT                   AALLPMAFVTGLMGPYMSPIPINSSLGMFISLAVAFVVTPWLAARLLAAAPPHPGVADT
FT                   PVASRLERLFRRLLTPFLDAHTGRRARRWLLLVIGLLILSSLALAGLKLVVLKMLPFDN
FT                   KSEFQIVLDMPAGTPLEETARVLREIGAEVVRVPEVSDYQAYAGTASPINFNGLVRQYY
FT                   LRAAPELGDLQVNLVDHRQRSRQSHEIAASVRAAVEAIGQRAGGNAKIVEVPPGPPVLS
FT                   PIVAEVYGPDYRGQIAVAREVRKVLEGTPDLVGVDDSVTAAGSKTVLHVLQNKAALLDV
FT                   AQSDIVEVVRMGLAGEDVTPVHNSESKFEIPVRLTLPAEQQSSIEALLKLRVRSRAGRL
FT                   VPVSELVEVREQPRETVVYHKDLLPVVYVVADMGGKLDSPLYGMFAARSDLVGRSLDGL
FT                   DKGAGTLGEWFIRQPAAPDAAYSIKWDGEWQITYETFRDMGIAYGVGLILIYLLVVAHF
FT                   RSYLLPLIIMAPIPLTIIGVMPGHALLGSQYTATSMIGMIALAGIIVRNSILLVDFIRQ
FT                   QIGEGMPLREAIIQSAAVRAKPIALTGLAAMLGALFILDDPIFNGLAISLIFGIFVSTL
FT                   LTLVVIPVLYYAAFRKEPQT"
FT                   /protein_id="YP_003165515.1"
FT   sig_peptide     complement(279360..279455)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.532 at
FT                   residue 32"
FT                   /locus_tag="CAP2UW1_0228"
FT   misc_feature    complement(276264..279410)
FT                   /note="Cation/multidrug efflux pump [Defense mechanisms];
FT                   Region: AcrB; COG0841"
FT                   /db_xref="CDD:31183"
FT                   /locus_tag="CAP2UW1_0228"
FT   misc_feature    complement(277986..>278342)
FT                   /note="Protein export membrane protein; Region: SecD_SecF;
FT                   cl14618"
FT                   /db_xref="CDD:176628"
FT                   /locus_tag="CAP2UW1_0228"
FT   gene            complement(279460..280482)
FT                   /db_xref="GeneID:8402356"
FT                   /locus_tag="CAP2UW1_0229"
FT   CDS_pept        complement(279460..280482)
FT                   /locus_tag="CAP2UW1_0229"
FT                   /gene_family="HOG000280653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   dar:Daro_3344 secretion protein HlyD"
FT                   /db_xref="GI:257091875"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:8402356"
FT                   /translation="MPDHTHRRWSLWQPLLASLAAAVSLTVQAQALPVMIMQPHPVELT
FT                   LPADALVEAVNQATVAAQVAGRVVEVHVDAGQAVRKGDLLMKIDAREASEVAAGASAQY
FT                   VNARAHYQRTVSLRQQGFVSQAAVDKAKADLDAAQAAHGQAAVGVGHATVRAPLTGIVA
FT                   QRLTEMGEMATPGKPLLVIHDPQGLRVTASIPQYRVPQMHAVRQARIEFPELGKVVDAT
FT                   SVTLLPTADAATHVSPVRVGLPPGFADIVPGMHARVHFVVGRANKMTVPQTAIVRRGEV
FT                   AAVYVQNEQEALSLRQLRLGEPVGTGEVEVLAGLRAGERVVLDPVKAAVALKSASPPGK
FT                   "
FT                   /protein_id="YP_003165516.1"
FT   sig_peptide     complement(280393..280482)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 30"
FT                   /locus_tag="CAP2UW1_0229"
FT   misc_feature    complement(279505..280386)
FT                   /note="RND family efflux transporter, MFP subunit; Region:
FT                   RND_mfp; TIGR01730"
FT                   /db_xref="CDD:162505"
FT                   /locus_tag="CAP2UW1_0229"
FT   gene            280665..282461
FT                   /db_xref="GeneID:8402357"
FT                   /locus_tag="CAP2UW1_0230"
FT   CDS_pept        280665..282461
FT                   /locus_tag="CAP2UW1_0230"
FT                   /gene_family="HOG000175619" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   pol:Bpro_3094 Gamma-glutamyltransferase 1. Threonine
FT                   peptidase. MEROPS family T03"
FT                   /db_xref="GI:257091876"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="GeneID:8402357"
FT                   /translation="MKLVCLALTTALLAIGCSNLAPALAPAPAAGTALHQPEGPSGVST
FT                   QPGWHGRRFAVATAHPLASEAGQQVLVAGGSAIDAAIAAQMVLTIVEPQSSGIGGGAFL
FT                   LYHDGRETVAFDGRETAPAAAGETLLMRPDGKPMDFHDAVVGGRAVGVPGAVRMLEVAH
FT                   ARYGRLPWASLFEPAIRLADSGFPLGARLYALLESDPHLRKDPGAAAYFYDPDGRALAT
FT                   GTLLRNPALAAVLRLIAAEGSPALYQGEIAQAIVDKVAKHPYNPGTLSMADLTTYSPKE
FT                   RTPLCTRYASRTAEPARTYRICGFPPPSSGAVAIAQILGILNHTEAPFLPFEDPRWMHF
FT                   YSEASRLAFADRAQYVADPDFVSAPAGDWLSLVRPDYLAARARLIGPMSMQVARPGLPS
FT                   PERSSHAPMPEQAEYGTSHISIVDAYGNALAMTSTIEDAFGARQMVRGFLLNNELTDFS
FT                   FTPTDASGAPVANRVQPGKRPRSSMSPTLVFDDDTGELVMSGGSPGGALIIHYTAKLLY
FT                   ATLNWGFAPQQAIDLPNFGSLNGPTLLEEKRFPPAFVEALRAAGHEVKEVGMTSGVQAI
FT                   RKDHGSYVGGADPRREGRVMGE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165517.1"
FT   sig_peptide     280665..280727
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.409 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_0230"
FT   misc_feature    280782..282455
FT                   /note="Gamma-glutamyltransferase [Amino acid transport and
FT                   metabolism]; Region: Ggt; cl08040"
FT                   /db_xref="CDD:186741"
FT                   /locus_tag="CAP2UW1_0230"
FT   misc_feature    280923..282443
FT                   /note="Gamma-glutamyltranspeptidase; Region:
FT                   G_glu_transpept; pfam01019"
FT                   /db_xref="CDD:144562"
FT                   /locus_tag="CAP2UW1_0230"
FT   gene            282461..283831
FT                   /db_xref="GeneID:8402358"
FT                   /locus_tag="CAP2UW1_0231"
FT   CDS_pept        282461..283831
FT                   /locus_tag="CAP2UW1_0231"
FT                   /gene_family="HOG000279724" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1615"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1615; KEGG:
FT                   cvi:CV_1672 hypothetical protein"
FT                   /db_xref="GI:257091877"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="GeneID:8402358"
FT                   /translation="MPAIMNRTHRQRPSTAFAPLATDSSSSHAQTGWRPAPVSPAWRLS
FT                   VLLCVAAVAGCATDGSYESRASPRARAALPADSSASSPAPLREASPITPTPPTLGSPAP
FT                   LPQPAPVPYPSANEARLALDRLLPTGISERSAWAVDILTAFASLRIPALAENLCATIAI
FT                   IAQESSFQADPPVPGLAHIVWQEIERRRERYAIPKVVLDLALLKSSPDGRTYRARIDAL
FT                   RTEKQMNALYEEMISELPAGRMLLGGYNPVRTGGPMQVSVTFAEEQVRNRPYPYTRRDS
FT                   IRDQVFTRRGGVYFGVAMLLDYPAAYSQMLYRFADFNAGRYSSRNAAFQSSVARLSGSP
FT                   LALDGDLLRYSDGSPAAEASDTQRAIQSLRVRLNLSEAEILRDLKLEKSFAFEQTPLYQ
FT                   RLYALADAAGAGKRPRELLPRIDLKSPKISRRLTTEWFARRVDERYRNCLERNVPAT"
FT                   /protein_id="YP_003165518.1"
FT   sig_peptide     282461..282550
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 30"
FT                   /locus_tag="CAP2UW1_0231"
FT   misc_feature    282848..283813
FT                   /note="Protein of unknown function (DUF1615); Region:
FT                   DUF1615; pfam07759"
FT                   /db_xref="CDD:149043"
FT                   /locus_tag="CAP2UW1_0231"
FT   gene            283938..284013
FT                   /note="tRNA-Phe1"
FT                   /db_xref="GeneID:8402359"
FT                   /locus_tag="CAP2UW1_R0005"
FT   tRNA            283938..284013
FT                   /db_xref="GeneID:8402359"
FT                   /locus_tag="CAP2UW1_R0005"
FT                   /product="tRNA-Phe"
FT   gene            284226..285326
FT                   /db_xref="GeneID:8402360"
FT                   /locus_tag="CAP2UW1_0232"
FT                   /pseudo
FT   gene            285369..286694
FT                   /db_xref="GeneID:8402361"
FT                   /locus_tag="CAP2UW1_0233"
FT   CDS_pept        285369..286694
FT                   /locus_tag="CAP2UW1_0233"
FT                   /gene_family="HOG000228794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3230 transposase"
FT                   /db_xref="GI:257091878"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8402361"
FT                   /translation="MGWAGEELKEVDLGDRRLNKRAITLLDTLAAKPTLSIPSACSGWS
FT                   ETIAAYRFLDNDAVTWEGILRPHWSCSRTRIACHKVVLMLQDTTELDFNGQSIDGLGPL
FT                   SYEAQRGLYVHPTYAVSTDREPLGVLDAWMWAREPKDANGQRPGIKESTRWVEGYERVA
FT                   ELAAELPDTRLVYVADRESDMIELMARAGELETPADWLLRAQHDRALPDGQKLWQTVTS
FT                   GEELGGISFTLPARHGQKARVVRQQLWARVVDLPHGKNKTIRATCVVAKEIDPPAGSTP
FT                   VEWRLLTNRTAETLAEVAELIDWYRARWEIEILFHILKNGCRIESLQLRTIDGLQRAIA
FT                   LYLIVSWRIAMLMRFGRTCPDLPADLFFDQDEWHAAYLLNKKKPPADPPTLNQVLRLVA
FT                   MLGGFLARKGDGEPGVKTIWIGLQRVMDCVVGLQFMREAAPG"
FT                   /protein_id="YP_003165519.1"
FT   misc_feature    <286203..286397
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="CAP2UW1_0233"
FT   gene            286763..287350
FT                   /db_xref="GeneID:8402362"
FT                   /locus_tag="CAP2UW1_0234"
FT   CDS_pept        286763..287350
FT                   /locus_tag="CAP2UW1_0234"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091879"
FT                   /db_xref="GeneID:8402362"
FT                   /translation="MRRHRPPLPDSGFKSLEIWDVPLRWDGKPWQPQNTGDNPAAFQRF
FT                   GVGDTMGERLGGAGRSNLTQVLLRRAIGKCTGEGTGVRRMHLYWRDGDQQWFYVVEAGR
FT                   ELETSIEQQGIKPLSVEAKGFLFTFDEEAEIDEIRASTGAFLKRDRLRLASVYFTQQPS
FT                   ADNSRLDYHCQVGLIGDSSVRGGEGGVNYLVR"
FT                   /protein_id="YP_003165520.1"
FT   gene            287433..288041
FT                   /db_xref="GeneID:8402363"
FT                   /locus_tag="CAP2UW1_0235"
FT   CDS_pept        287433..288041
FT                   /locus_tag="CAP2UW1_0235"
FT                   /gene_family="HOG000014168" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xom:XOO_2998 hypothetical protein"
FT                   /db_xref="GI:257091880"
FT                   /db_xref="GeneID:8402363"
FT                   /translation="MPDMDTTAERLIELARSRGLIRPCDLAPFGIPRVSLTRAVRSGLL
FT                   ERIGRGLYGLPGREVSAHGLLAEVARRVPKGVVCLLSALRFHGLTTQAPFEVWLAIENK
FT                   ALAPKLDYPPLRIVRFSGKAFTEGVEEHVVDSVTIRITGVAKTVADCFKYRNKIGLDVA
FT                   LEALREAWHERRMSSDDIWRYAKVCRVANVMRPYLDSLT"
FT                   /protein_id="YP_003165521.1"
FT   misc_feature    287448..>287942
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG5340"
FT                   /db_xref="CDD:34917"
FT                   /locus_tag="CAP2UW1_0235"
FT   gene            288038..288961
FT                   /db_xref="GeneID:8402364"
FT                   /locus_tag="CAP2UW1_0236"
FT   CDS_pept        288038..288961
FT                   /locus_tag="CAP2UW1_0236"
FT                   /gene_family="HOG000014147" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Domain of unknown function DUF1814"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   xom:XOO_2997 hypothetical protein"
FT                   /db_xref="GI:257091881"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="GeneID:8402364"
FT                   /translation="MSVRNIGAAIRNRLLNKARAENLDYNLLLTRYALERMLYRLSISE
FT                   QRDQLVLKGALLFDLWFDVPHRPTHDADLLGFGPAEIPHIEQVFRSMCSIEVEDGIVFQ
FT                   PDSVKATEIRKEASYSGLRVTLVGMLDSARCPVQIDIGFGDAVVPGPDEVHYPVILSEM
FT                   AGPQLRAYPRYTVVAEKLEALTSLGMLNSRMKDFFDLWVLARHSDFDGPILSRAVAATF
FT                   ERRRTPIPHGAPIGLSDEFINDAQKNKQWQAFLRKNALDPMPLAKVIADLREFLLPVLA
FT                   SVEASGSHDMAWWCREGWRQLTEHGT"
FT                   /protein_id="YP_003165522.1"
FT   misc_feature    288143..288865
FT                   /note="Domain of unknown function (DUF1814); Region:
FT                   DUF1814; cl00973"
FT                   /db_xref="CDD:154118"
FT                   /locus_tag="CAP2UW1_0236"
FT   gene            complement(289225..291462)
FT                   /db_xref="GeneID:8402365"
FT                   /locus_tag="CAP2UW1_0237"
FT   CDS_pept        complement(289225..291462)
FT                   /locus_tag="CAP2UW1_0237"
FT                   /gene_family="HOG000200154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="KEGG: rca:Rcas_1875 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="GI:257091882"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR015913"
FT                   /db_xref="GeneID:8402365"
FT                   /translation="MNMNNKSPPKSIGVLTSGGDAQGMNAAVRAVVRTALHQGAAVYAI
FT                   YEGYQGMVDGGERIRLQSWDDVGSILHRGGTIIGTARCAAFRERAGRLRAAHNLLRHGI
FT                   DRLVIIGGDGSLTGADTFRREWPGLLAELLESGQIDEQTARAHPALMIAGLVGSIDNDM
FT                   VGTDMTIGADSALHRIVEAIDAIASTAASHQRSFVVEVMGRHCGYLALMSAIAGGTDYV
FT                   LIPESPPPEGWEEQMCGLLRQGRIAGRRDSIVVVAEGAQDRAGNPISCDYVRQVLQERL
FT                   DEDTRVTILGHVQRGGTPSSFDRWMSTLLGFAAVQEVLSATPDSEPQLIGIRQNRIQRV
FT                   PLMQCVEQTRAVAQMIGEQNYARAMELRGGSFTEMFDVFKAIAEASPSVTATTRPRRLA
FT                   IIHAGGLAPGMNSAVRAAVRFGRDRGLTLLGVRGSFEGLLAGRIEELTWGDVEGWTGLG
FT                   GCELGTNRHIPSVEELYAVARAIETHQIEGLLVIGGWMAYKAAYQLHCERDRYPAFKIP
FT                   IICLPATIDNNLPGSELSVGADSALNAIVGALDRVKQSAMAAKRCFVVETMGRYCGYLA
FT                   LMSGLAGGAERVYLHEEGVTLKDLQAEVEHMVDAFHTGRRLYLTIRNERANAQYTTDFM
FT                   CALFEEEGRGLFDVRRSVLGHFQQGGNPSPYDRILATRLAAHCISFLSEQLASGSADGA
FT                   FIGLVEGKVTLVPLGRMSEMVDWTHFRPKEQWWLELRPVVQTMAQSIATEA"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165523.1"
FT   misc_feature    complement(289246..291435)
FT                   /note="Phosphofructokinase, a key regulatory enzyme in
FT                   glycolysis, catalyzes the phosphorylation of
FT                   fructose-6-phosphate to fructose-1,6-biphosphate. The
FT                   members belong to PFK family that includes ATP- and
FT                   pyrophosphate (PPi)- dependent phosphofructokinases...;
FT                   Region: PFK; cl00204"
FT                   /db_xref="CDD:185826"
FT                   /locus_tag="CAP2UW1_0237"
FT   misc_feature    complement(289249..291435)
FT                   /note="6-phosphofructokinase, eukaryotic type; Region:
FT                   6PF1K_euk; TIGR02478"
FT                   /db_xref="CDD:162876"
FT                   /locus_tag="CAP2UW1_0237"
FT   misc_feature    complement(order(290578..290580,290587..290589,
FT                   290689..290691,290851..290859,290977..290979,
FT                   290983..290985,290989..290991,291109..291114,
FT                   291118..291126,291217..291219,291316..291318,
FT                   291406..291408))
FT                   /note="active site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="CAP2UW1_0237"
FT   misc_feature    complement(order(291109..291114,291118..291126,
FT                   291217..291219,291316..291318,291406..291408))
FT                   /note="ADP/pyrophosphate binding site; other site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="CAP2UW1_0237"
FT   misc_feature    complement(order(290332..290334,290470..290472,
FT                   290515..290517,290536..290538,290548..290553,
FT                   290716..290718,290809..290811,290815..290820,
FT                   290902..290904,290911..290913,290923..290925,
FT                   290959..290961,291247..291249,291256..291258,
FT                   291271..291273,291364..291366,291376..291378))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="CAP2UW1_0237"
FT   misc_feature    complement(order(290710..290718,290722..290724,
FT                   290803..290805,290809..290811,290902..290904,
FT                   291256..291261,291268..291273,291364..291366,
FT                   291376..291378))
FT                   /note="allosteric effector site; other site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="CAP2UW1_0237"
FT   misc_feature    complement(order(290578..290580,290587..290589,
FT                   290605..290607,290689..290691,290851..290859,
FT                   290878..290880,290977..290979,290983..290985,
FT                   290989..290991))
FT                   /note="fructose-1,6-bisphosphate binding site; other site"
FT                   /db_xref="CDD:29437"
FT                   /locus_tag="CAP2UW1_0237"
FT   gene            complement(291643..293850)
FT                   /db_xref="GeneID:8402366"
FT                   /locus_tag="CAP2UW1_0238"
FT   CDS_pept        complement(291643..293850)
FT                   /locus_tag="CAP2UW1_0238"
FT                   /gene_family="HOG000146765" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dar:Daro_1633 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="GI:257091883"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="GeneID:8402366"
FT                   /translation="MNARNPSLVDQLSAMDARIRFIISVIVLGLLMTGPFVITAILIWA
FT                   SAQPAEQELLVQLIAPHLSLGALMTTFGFILGLLVIRYLFRQYVQGLLKMVENLRLMLS
FT                   ANRDFRVTPEGPPEVRLLAEATNDLAQQRDGLMDDVEAQIATAKASVEAEKNRLAALMS
FT                   ELAQAVVVCNLDGRILLYNSRARLQFKALAQGGTAIAGGALIGLGRSIFSILERNQIDH
FT                   ALEVVRQRLDKGAAAAIANFITTARGGQLLRVQLVPVLAAGEDLRQRDMTGYVLTVENI
FT                   TRSLEQESRRDQVLQSLTDGSRGCLANIRVAVGNLMDYPDMELEIRERFVGIISDEVVR
FT                   MSQRLDQTMSEFADSLKTRWPLEDVLGLDIVAAAQRRIEQQLGLPTKSEEIDEALWLRV
FT                   ESFSLVFSICFLASRLIDNYQIKELRFRLLPFGKLAYLDLIWAGHAMSTETSYTWETET
FT                   MQVGKEISPLSLRDVIDRHGGEIWYEREKAAQRAFFRFVLPVAAPDELGASEMIDDSGV
FT                   RPEYYDFDLFHFQDQSIDLDRPLSDLTYTVFDTETTGMEPAAGDEIIQIGAVRIVNGRL
FT                   LRNENFDQLVDPERFIRPEGIRIHGISDDMVRGQPNIEVVLPALHDFCNDTVLVAHNAA
FT                   FDMRFLQLKEERTGVAFSQPVLDTLLLSGVLHPNQESHQLDSIAERLGIGIEDRHNALG
FT                   DACATAEVFLKMLPLLAQMGITTLRQALEASEKTYFARVKY"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165524.1"
FT   misc_feature    complement(<293368..>293694)
FT                   /note="Signal transduction histidine kinase,
FT                   nitrate/nitrite-specific [Signal transduction mechanisms];
FT                   Region: NarQ; COG3850"
FT                   /db_xref="CDD:33640"
FT                   /locus_tag="CAP2UW1_0238"
FT   misc_feature    complement(291739..292212)
FT                   /note="DEDDh 3'-5' exonuclease domain family; Region:
FT                   DEDDh; cd06127"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="CAP2UW1_0238"
FT   misc_feature    complement(order(291766..291768,291781..291783,
FT                   291940..291948,291952..291957,292189..292191,
FT                   292195..292206))
FT                   /note="active site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="CAP2UW1_0238"
FT   misc_feature    complement(order(291766..291768,291781..291783,
FT                   291943..291948,291952..291957,292189..292191,
FT                   292195..292206))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="CAP2UW1_0238"
FT   misc_feature    complement(order(291766..291768,291781..291783,
FT                   291940..291942,292198..292200,292204..292206))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:176648"
FT                   /locus_tag="CAP2UW1_0238"
FT   gene            complement(294228..294374)
FT                   /db_xref="GeneID:8402367"
FT                   /locus_tag="CAP2UW1_0239"
FT   CDS_pept        complement(294228..294374)
FT                   /locus_tag="CAP2UW1_0239"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091884"
FT                   /db_xref="GeneID:8402367"
FT                   /translation="MIKANWLAGLLALALFSHAQYQGWSLFDREAGAQTARVAGTAGRG
FT                   YHK"
FT                   /protein_id="YP_003165525.1"
FT   sig_peptide     complement(294315..294374)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.812 at
FT                   residue 20"
FT                   /locus_tag="CAP2UW1_0239"
FT   gene            complement(294376..296277)
FT                   /db_xref="GeneID:8402368"
FT                   /locus_tag="CAP2UW1_0240"
FT   CDS_pept        complement(294376..296277)
FT                   /locus_tag="CAP2UW1_0240"
FT                   /gene_family="HOG000133733" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_3751 hypothetical protein"
FT                   /db_xref="GI:257091885"
FT                   /db_xref="GeneID:8402368"
FT                   /translation="MKRAICPSCGAPVLFHSAASIYAVCEFCRSTLLRTGEDLQNLGRM
FT                   ADLLDDTSRIQIGSEGTFRSRHFLVVGRIQLKYEAGLWNEWHILFDDGRSAWLAEAAGE
FT                   YIVSAQVSVREPIPAFTVLVPEMAVTLDGRQFTVTDLETARCISGQGELPFRVAAGYDV
FT                   NTADLRSNDRFLTIDYSETPPLVFVGQSTTFVDLKLVNLREASEPSAGGAPQVGARAFN
FT                   CPHCAAPLQIHSPAIESVACDACGSIIGIDNENVRLLARAAQALREVPWLPLGSRGSLH
FT                   GVDWEVIGFMRRSTTSEGTEYPWSEYLLFNATDGFAWLIEYQGHWNFARTLAKPPSVSR
FT                   KQPKFKLDGKEFKLFNRGKAQVTYVVGEFYWRVTVGETCAVDDYVCPPLMLSREVTAKE
FT                   ASWSQAEYLEAADLCAAFRMKTPLPRSGVYANQPNPLAETHRTTCSLFWKLALAATAVQ
FT                   LAFTFLFASQLVLKQQLVLSPQNEEATLTSQEFVLKSRARALLVRHATDVTNNWLSLST
FT                   TLVEKNTGESYQGEQEVSHYKGVDDGESWSEGSPSEEMVFKAVPAGTYYLVLEYELGTD
FT                   DAAAVVDTLEVVRNPTVWSNFVLLLIFLAIFPLISRWRRNAFEARRWSESDLGGKDD"
FT                   /protein_id="YP_003165526.1"
FT   gene            complement(296346..297389)
FT                   /db_xref="GeneID:8402369"
FT                   /locus_tag="CAP2UW1_0241"
FT   CDS_pept        complement(296346..297389)
FT                   /locus_tag="CAP2UW1_0241"
FT                   /gene_family="HOG000216603" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="band 7 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: band 7 protein; KEGG: dar:Daro_3752 putative
FT                   transmembrane protein"
FT                   /db_xref="GI:257091886"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="GeneID:8402369"
FT                   /translation="MAFMDFIKKQFIDVIQWTEQGDGVLAMRYPMQDFEIQYGAQLTVR
FT                   ESQMAIFVNEGKIADVFGPGLYKLTTRTLPVLTYLKNWDKLFESPFKSDVYFFSTRLQL
FT                   DRKWGTPNPITIRDKDFGMVRMRAFGIYSYKLTDPRKLHTEVSGTREQYMVDDLDGQLR
FT                   NLVIGSMTDLFGESGVPFIDMAANQDELGRTLKGKLEPVFERYGLALDSFVVQNVSLPE
FT                   ELQKVLDSRIGMNMIGDLGRYTQYQVANSIPLAAQNEGGIAGIGAGLGAGLGIGQAMSA
FT                   AMGQAVQAGSAPQQPMSPATPTAAAAASSADEVVATLEKLHGLVAKGILSQAEFDVKKA
FT                   ELLGKLV"
FT                   /protein_id="YP_003165527.1"
FT   misc_feature    complement(296694..297314)
FT                   /note="A subgroup of the band 7 domain of flotillin
FT                   (reggie) like proteins. This subgroup contains proteins
FT                   similar to stomatin, prohibitin, flotillin, HlfK/C and
FT                   podicin.  Many of these band 7 domain-containing proteins
FT                   are lipid raft-associated.  Individual...; Region:
FT                   Band_7_5; cd03408"
FT                   /db_xref="CDD:48220"
FT                   /locus_tag="CAP2UW1_0241"
FT   gene            complement(297460..297864)
FT                   /db_xref="GeneID:8402370"
FT                   /locus_tag="CAP2UW1_0242"
FT   CDS_pept        complement(297460..297864)
FT                   /locus_tag="CAP2UW1_0242"
FT                   /gene_family="HOG000216615" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF350"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   dar:Daro_3753 protein of unknown function DUF350"
FT                   /db_xref="GI:257091887"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="GeneID:8402370"
FT                   /translation="MPTHLLTMLPAFLAYFAVAIALLALFLLVYLNVTPYHEVALIRGG
FT                   NNAAAVSLSGALLGFAMPVANVIAHSDTLLDLASWGAIAGVIQILAYLVARLALPQLDQ
FT                   DIPAGKTAPAIFLAVLSLSVGLINAACMTY"
FT                   /protein_id="YP_003165528.1"
FT   sig_peptide     complement(297799..297864)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.387 at
FT                   residue 22"
FT                   /locus_tag="CAP2UW1_0242"
FT   misc_feature    complement(297469..297627)
FT                   /note="Domain of Unknown Function (DUF350); Region: DUF350;
FT                   pfam03994"
FT                   /db_xref="CDD:146565"
FT                   /locus_tag="CAP2UW1_0242"
FT   gene            complement(297899..298618)
FT                   /db_xref="GeneID:8402371"
FT                   /locus_tag="CAP2UW1_0243"
FT   CDS_pept        complement(297899..298618)
FT                   /locus_tag="CAP2UW1_0243"
FT                   /gene_family="HOG000066026" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: eba:ebA4111 pantothenate
FT                   kinase"
FT                   /db_xref="GI:257091888"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="GeneID:8402371"
FT                   /translation="MIVAIDAGNSRIKWGVNDGNAWLDSGVLATADVAWLSEAADEWPA
FT                   NARVAICNVAGPEVAESISSLLAPRHATISFLRARVAACGVRNTYERPEQLGADRWAAL
FT                   IGARGMLAGACLVVCAGTATTIDLLDATGVFRGGLILPGFDLMRTALAHNTAQLPLAEG
FT                   VFRAEPRNTLDAIFSGCLQAQLGAVERMFAGIAAEPDARCLLTGGGAGSLAAHLKVPCQ
FT                   LVDNLILNGLARFAASP"
FT                   /protein_id="YP_003165529.1"
FT   misc_feature    complement(297902..298618)
FT                   /note="Bordetella pertussis Bvg accessory factor family;
FT                   Region: Bvg_acc_factor; cl09130"
FT                   /db_xref="CDD:186836"
FT                   /locus_tag="CAP2UW1_0243"
FT   gene            complement(298615..299421)
FT                   /db_xref="GeneID:8402372"
FT                   /locus_tag="CAP2UW1_0244"
FT   CDS_pept        complement(298615..299421)
FT                   /locus_tag="CAP2UW1_0244"
FT                   /gene_family="HOG000041813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: dar:Daro_3757 biotin--acetyl-CoA-carboxylase
FT                   ligase; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase"
FT                   /db_xref="GI:257091889"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="GeneID:8402372"
FT                   /translation="MDDSSVTCRIDPARLKLRLAAASDRFAVEALPECVSTSTLLLERA
FT                   RQGAPSGALLVADRQTAGRGRRGRSWLSSPAGSLTFSLLWRFACPVARLAGLSLAVGVA
FT                   VARALEASGVAGIELKWPNDILLDGGKVGGILIELEAAPGSMLAVIGIGLNLQLPATGD
FT                   EEMLHPPAALAQALSPVPDRHQLLAQLLIDLATVLDGFAESGFAAVRDDWQARHAWQGR
FT                   YVRLLNGGLVDREGKCLGADTDGALLLKTAAGVERCLSGDLSLRAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165530.1"
FT   misc_feature    complement(298618..>299394)
FT                   /note="bifunctional biotin--[acetyl-CoA-carboxylase]
FT                   synthetase/biotin operon repressor; Provisional; Region:
FT                   PRK11886"
FT                   /db_xref="CDD:183359"
FT                   /locus_tag="CAP2UW1_0244"
FT   misc_feature    complement(298957..299316)
FT                   /note="Biotin/lipoate A/B protein ligase family; Region:
FT                   BPL_LplA_LipB; cl14057"
FT                   /db_xref="CDD:187213"
FT                   /locus_tag="CAP2UW1_0244"
FT   gene            complement(299460..300890)
FT                   /db_xref="GeneID:8402373"
FT                   /locus_tag="CAP2UW1_0245"
FT   CDS_pept        complement(299460..300890)
FT                   /locus_tag="CAP2UW1_0245"
FT                   /gene_family="HOG000058489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_3758 helix-turn-helix,
FT                   fis-type:nitrogen regulation protein NR(I); TIGRFAM:
FT                   nitrogen regulation protein NR(I); PFAM: response regulator
FT                   receiver; sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="GI:257091890"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="GeneID:8402373"
FT                   /translation="MKPVWIVDDDKSIRWVLEKTLSREKIPFQSFASATEALARLDAGG
FT                   DPPQVLVSDIRMPGQSGLELLQLFKERFPAIPVIIMTAYSDLESAVSAFQGGAFEYLPK
FT                   PFDVDQALELIRRAIGESLHQSGAPNEVGLMPEILGQAPAMQEVFRAIGRLSQSSATVL
FT                   ITGESGSGKELVARAVHRHSPRADKPFIAINTAAIPRDLLESELFGHERGAFTGAAAQR
FT                   QGRFEQAEGGTLFLDEIGDMPAELQTRLLRVLSDGHYYRVGGHSPLKTKVRIIAATHQN
FT                   LEERVRQGLFREDLFHRLNVIRVRLPSLGERREDIPILARHFLQKSAHELGVEGKRFSD
FT                   AALKHLCSVDFPGNVRQLENLCHWLTVMAPGQLVELADLPPELRDAQVSAQSGDWEDAL
FT                   AQEVDRLLISEPGHVHETLTHAFERVLINRALSHTGGRRIEAAHSLGIGRNTITRKIQE
FT                   LGLDSAGASEDREASLQR"
FT                   /protein_id="YP_003165531.1"
FT   misc_feature    complement(299514..300881)
FT                   /note="nitrogen regulation protein NR(I); Region: ntrC;
FT                   TIGR01818"
FT                   /db_xref="CDD:162545"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(300534..300875)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(order(300576..300581,300588..300590,
FT                   300645..300647,300705..300707,300729..300731,
FT                   300864..300869))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(300729..300731)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(order(300705..300713,300717..300722))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(300573..300581)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(299967..300473)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(300372..300395)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(order(300054..300056,300180..300182,
FT                   300369..300392))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(300177..300194)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(299997..299999)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0245"
FT   misc_feature    complement(299514..299630)
FT                   /note="Bacterial regulatory protein, Fis family; Region:
FT                   HTH_8; cl01091"
FT                   /db_xref="CDD:186327"
FT                   /locus_tag="CAP2UW1_0245"
FT   gene            complement(300951..302057)
FT                   /db_xref="GeneID:8402374"
FT                   /locus_tag="CAP2UW1_0246"
FT   CDS_pept        complement(300951..302057)
FT                   /locus_tag="CAP2UW1_0246"
FT                   /gene_family="HOG000262169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: dar:Daro_3759
FT                   ATP-binding region, ATPase-like:histidine kinase A,
FT                   N-terminal"
FT                   /db_xref="GI:257091891"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:8402374"
FT                   /translation="MPGTRCDLDTPVTEPSANPFGGLDLLSSAVLLLDETLAIRYMNAA
FT                   AENLLEISGKVFAGCRLDSVAECPPKLLAALDSALHHGWAYTGQSIELRVAGGEILKLN
FT                   CTVNPAEAPQARLLVELWPIDQQLKATREERLVEQQHANRELIRNLVHEIKNPLGGIRG
FT                   AAQLLEHELNNPGLREYTQVIIKEADRLQDLMRRLLSPHRPMQPGPVNIHEILERVRSL
FT                   LTAEFPTILAVCRDYDTSLPELIGDREQLIQVFLNVARNAAQAIRWQPDGSVVGQGQIT
FT                   LRTRVARQMTLCKRRYPLALEVQVIDDGPGIPEDIRERMFYPLVSGREGGSGLGLTLAQ
FT                   SFVQQHQGTIDCESRPGHTCFTIRLPLA"
FT                   /protein_id="YP_003165532.1"
FT   misc_feature    complement(300954..301946)
FT                   /note="Signal transduction histidine kinase, nitrogen
FT                   specific [Signal transduction mechanisms]; Region: NtrB;
FT                   COG3852"
FT                   /db_xref="CDD:33642"
FT                   /locus_tag="CAP2UW1_0246"
FT   misc_feature    complement(301458..301640)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0246"
FT   misc_feature    complement(order(301464..301466,301476..301478,
FT                   301485..301487,301497..301499,301506..301508,
FT                   301518..301520,301566..301568,301575..301577,
FT                   301587..301589,301596..301598,301608..301610,
FT                   301620..301622))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0246"
FT   misc_feature    complement(301602..301604)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="CAP2UW1_0246"
FT   misc_feature    complement(300963..301307)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0246"
FT   misc_feature    complement(order(300975..300977,300981..300983,
FT                   300996..300998,301002..301004,301050..301061,
FT                   301122..301127,301131..301133,301137..301139,
FT                   301143..301145,301266..301268,301275..301277,
FT                   301287..301289))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0246"
FT   misc_feature    complement(301275..301277)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0246"
FT   misc_feature    complement(order(301053..301055,301059..301061,
FT                   301125..301127,301131..301133))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="CAP2UW1_0246"
FT   gene            complement(302057..302548)
FT                   /db_xref="GeneID:8402375"
FT                   /locus_tag="CAP2UW1_0247"
FT   CDS_pept        complement(302057..302548)
FT                   /locus_tag="CAP2UW1_0247"
FT                   /gene_family="HOG000219754" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_3762 hypothetical protein"
FT                   /db_xref="GI:257091892"
FT                   /db_xref="GeneID:8402375"
FT                   /translation="MKRQDLCIAFALLSLLAVPAQAQDIYKCDLDGRITYSNVPSKNCR
FT                   KIMLDPVNLAPANKAAPKASTSTPTPGSFPKVDDQTQKSRDTDRRRILESELTAEQANA
FT                   DQAKKELAEQEATVLPNERMQGGAISGGKVQERLQPYKDKVALHQRNVEAIRKEISNLR
FT                   "
FT                   /protein_id="YP_003165533.1"
FT   sig_peptide     complement(302480..302548)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT                   /locus_tag="CAP2UW1_0247"
FT   gene            complement(302733..304148)
FT                   /db_xref="GeneID:8402376"
FT                   /locus_tag="CAP2UW1_0248"
FT   CDS_pept        complement(302733..304148)
FT                   /locus_tag="CAP2UW1_0248"
FT                   /gene_family="HOG000005157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamine synthetase, type I"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: dar:Daro_3763 L-glutamine synthetase"
FT                   /db_xref="GI:257091893"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="GeneID:8402376"
FT                   /translation="MASPQDVIKMVKENEAKFVDFRFTDTRGKEQHVTVPVSAFGEDKF
FT                   ENGHAFDGSSIAGWKGIQASDMQLMPDPSTAYVDPFFDETTVVITCDVVDPADGRGYDR
FT                   DPRSIANRAEAYLKSCGIGDTAYFGPEPEFFIFDSVAWSVDMSGCNLKIYSQEAAWTSG
FT                   EKSDSEGGTGHRPGVKGGYFPVPPVDSLHDIRSAMVLTLESVGVPVEVHHHEVATAGQC
FT                   EIGTVFSTLVKRADWTQILKYVVHNVAHQYGKTATFMPKPIVGDNGSGMHVHQSIWKDG
FT                   KNLFAGNGYAGLSELALFYIGGIIKHAKALNAITNPGTNSYKRLVPHYEAPVKLAYSAK
FT                   NRSASIRVPHVASDKARRIETRFPDPIANPYLCFSALLMAGLDGIQNKIHPGDPADKNL
FT                   YDLPPEEDAKIPTVCASLEEALAALDKDREFLTRGGVFSEDWIDAFIELKMEEVNKVRM
FT                   TTHPVEFDLYYSC"
FT                   /protein_id="YP_003165534.1"
FT   misc_feature    complement(302736..304142)
FT                   /note="glutamine synthetase; Provisional; Region: glnA;
FT                   PRK09469"
FT                   /db_xref="CDD:181884"
FT                   /locus_tag="CAP2UW1_0248"
FT   misc_feature    complement(303861..304106)
FT                   /note="Glutamine synthetase, beta-Grasp domain; Region:
FT                   Gln-synt_N; pfam03951"
FT                   /db_xref="CDD:146534"
FT                   /locus_tag="CAP2UW1_0248"
FT   misc_feature    complement(303006..303842)
FT                   /note="Glutamine synthetase, catalytic domain; Region:
FT                   Gln-synt_C; pfam00120"
FT                   /db_xref="CDD:143894"
FT                   /locus_tag="CAP2UW1_0248"
FT   gene            304453..304902
FT                   /db_xref="GeneID:8402377"
FT                   /locus_tag="CAP2UW1_0249"
FT   CDS_pept        304453..304902
FT                   /locus_tag="CAP2UW1_0249"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rhodanese domain protein"
FT                   /transl_table="11"
FT                   /note="SMART: Rhodanese domain protein; KEGG: eba:ebA4122
FT                   rhodanese-like protein"
FT                   /db_xref="GI:257091894"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:8402377"
FT                   /translation="MGKLTDLLKLAQARASELALPYAGALTPQEAHEVWQLAPGAKLID
FT                   VRTRAEWDWVGRIPGAIEIEWLSYPDNRPNTHFLAQLKQQVDREALLMFICRSGMRSHN
FT                   AAALASEAAHLECYNVLEGFEGDKDANGQRGKVGGWRRAGLPWRS"
FT                   /protein_id="YP_003165535.1"
FT   misc_feature    304528..304875
FT                   /note="Member of the Rhodanese Homology Domain superfamily,
FT                   subgroup 1. This CD includes the putative rhodanese-related
FT                   sulfurtransferases of several uncharacterized proteins;
FT                   Region: RHOD_1; cd01522"
FT                   /db_xref="CDD:29085"
FT                   /locus_tag="CAP2UW1_0249"
FT   misc_feature    304738..304740
FT                   /note="active site residue"
FT                   /db_xref="CDD:29085"
FT                   /locus_tag="CAP2UW1_0249"
FT   gene            304957..306054
FT                   /db_xref="GeneID:8402378"
FT                   /locus_tag="CAP2UW1_0250"
FT   CDS_pept        304957..306054
FT                   /locus_tag="CAP2UW1_0250"
FT                   /gene_family="HOG000222768" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: azo:azo0741 quinolinate synthetase; TIGRFAM:
FT                   quinolinate synthetase complex, A subunit; PFAM:
FT                   Quinolinate synthetase A"
FT                   /db_xref="GI:257091895"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="GeneID:8402378"
FT                   /translation="MQTATISFDTFNQLRDEESHQRIRAARERLGDRAVLLCHHYQRAD
FT                   VYQYADLTGDSLKLSRLASQTESEFIVFCGVHFMAEVADIMSKPDQIAILPDLAAGCSM
FT                   ADMANLAKVERCWRELGEVLDVEQQVTPVTYINSAADLKAFCGARGGIVCTSSNAGTIA
FT                   AWAFERREKILFFPDQHLGRWTGYQMGIPLDEMMVWDPDLEMGGLTAEQIRRARLLLWK
FT                   GHCSVHQMFQPAHILRFRNQHPDGLVIAHPECSFEVCRQSDFVGSTEHIVRTIKEAPAN
FT                   TRWLVGTELNLVNRLAEEVKGEGKIVQFMAPTVCMCSTMQRIDPQHLAWTLENLAEGTV
FT                   VNQIQVPEHERELAKLALDRMLGVS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165536.1"
FT   misc_feature    304957..306051
FT                   /note="Quinolinate synthetase A protein; Region: NadA;
FT                   cl00420"
FT                   /db_xref="CDD:185987"
FT                   /locus_tag="CAP2UW1_0250"
FT   gene            306112..307050
FT                   /db_xref="GeneID:8402379"
FT                   /locus_tag="CAP2UW1_0251"
FT   CDS_pept        306112..307050
FT                   /locus_tag="CAP2UW1_0251"
FT                   /gene_family="HOG000227780" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   nmu:Nmul_A0297 glycosyl transferase, family 2"
FT                   /db_xref="GI:257091896"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:8402379"
FT                   /translation="MPVVSVVIPAYNCALYIGETLASILAQEAAELEIIVINDGSTDET
FT                   GAIARSFGEPVRVIDQPNSGVCAARNHGIREARGEFIALVDHDDYWLPNKLANQLAAFA
FT                   DNPQVDVVFTAFVWWRQESEGGRFPQPASFAAQAAPQGIDSDFSGWIYHQMLLDSWVLT
FT                   STALARSAVVRASGGFDETLPFSEDWDFWLRVARTSQFLKLREATTLYRQHPHQGSRVT
FT                   RALDYRTRLLEQASRQWGLSSQDGRCVAPGVFRRQLAQYSASFGLGHLQGGPGASRLIA
FT                   AKAFLKAWRIDPTYWKSLLYLAATPFYGKSR"
FT                   /protein_id="YP_003165537.1"
FT   misc_feature    306127..>306465
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cd00761"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="CAP2UW1_0251"
FT   misc_feature    order(306136..306138,306142..306144,306220..306222,
FT                   306367..306369,306373..306375)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="CAP2UW1_0251"
FT   gene            307067..307936
FT                   /db_xref="GeneID:8402380"
FT                   /locus_tag="CAP2UW1_0252"
FT   CDS_pept        307067..307936
FT                   /locus_tag="CAP2UW1_0252"
FT                   /gene_family="HOG000261998" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hsp33 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Hsp33 protein; KEGG: tbd:Tbd_0750 disulfide
FT                   bond chaperone, HSP33 family"
FT                   /db_xref="GI:257091897"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="GeneID:8402380"
FT                   /translation="MVSDCLWRFLFDDLDISGAFVRLGPVWRNMLDGRGYPAPVARLLG
FT                   ELTATTLLLGGKLKQPGRLTVQLRGNGPISLLVIDCDEQLHIRGMARFSAPLAGESAPE
FT                   LLGDGQLLLSLDMPSMREPYQSIVPLAGTSVAEIFEHYLGQSDQLPSRFLLVTTPDAAA
FT                   GLLVQRMPGADACDADGWARIEALAATVRPAEILSLPADQLLLRLFPDEAVRLFPARTV
FT                   AYHCPEDWQKVRSMLRVLGPAEVYAALHEQGEVVIRDEICNREYRFDEAAVDELFGGSS
FT                   PGEPPTIH"
FT                   /protein_id="YP_003165538.1"
FT   misc_feature    307073..307909
FT                   /note="Hsp33-like chaperonin; Reviewed; Region: hslO;
FT                   PRK00114"
FT                   /db_xref="CDD:178874"
FT                   /locus_tag="CAP2UW1_0252"
FT   misc_feature    307082..307873
FT                   /note="Heat shock protein 33 (Hsp33):  Cytosolic protein
FT                   that acts as a molecular chaperone under oxidative
FT                   conditions.  In normal (reducing) cytosolic conditions,
FT                   four conserved Cys residues are coordinated by a Zn ion.
FT                   Under oxidative stress (such as heat...; Region: Hsp33;
FT                   cd00498"
FT                   /db_xref="CDD:29605"
FT                   /locus_tag="CAP2UW1_0252"
FT   misc_feature    order(307115..307117,307490..307492,307502..307510,
FT                   307568..307570,307742..307744)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29605"
FT                   /locus_tag="CAP2UW1_0252"
FT   misc_feature    order(307115..307117,307550..307552,307556..307558,
FT                   307568..307579)
FT                   /note="domain crossover interface; other site"
FT                   /db_xref="CDD:29605"
FT                   /locus_tag="CAP2UW1_0252"
FT   misc_feature    order(307742..307744,307748..307750,307841..307843,
FT                   307850..307852)
FT                   /note="redox-dependent activation switch; other site"
FT                   /db_xref="CDD:29605"
FT                   /locus_tag="CAP2UW1_0252"
FT   gene            complement(308014..309423)
FT                   /db_xref="GeneID:8402381"
FT                   /locus_tag="CAP2UW1_0253"
FT   CDS_pept        complement(308014..309423)
FT                   /locus_tag="CAP2UW1_0253"
FT                   /gene_family="HOG000230997" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD linked oxidase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dar:Daro_2750 FAD linked oxidase, C-terminal:FAD linked
FT                   oxidase, N-terminal"
FT                   /db_xref="GI:257091898"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="GeneID:8402381"
FT                   /translation="MKDAPLIRTLADLLGADQVLTSAADMSAYLADWRGRYRGAATCVV
FT                   RPASTAAVAAVVRACAEAAMPIVPQGGNTGLCGAATPAGDGHAVVVSLTRLNRVRQIDT
FT                   ANNTMTVEAGCVLATLQAAAAQAGRLFPLSLAAEGSCQIGGNLSTNAGGVQVLRYGNAR
FT                   DLTLGLEVVLASGEIWDGLRGLRKDNTGYDLKHLFIGAEGTLGIITAAVLKLFPLPRAN
FT                   ATAWLAIASPAAAVRLLADLQARFASTLTACELVSDVALGLVRQHIPGPHPALSASPWH
FT                   LLIELSAGGDEGELREALGALLAEALASGTISDAVLAQSGEQARRLWAMRENIGEAQRI
FT                   DGLSIKHDVSVPISRIPEFVERADQALTEAFPGLRIVAFGHIGDGNLHYNQSQAAAGLN
FT                   AAFLAAQPTVNRIVHDLVDELGGSISAEHGIGQLKRDELLRYKSPVEIEMMRAIKRVLD
FT                   PQGLMNPGKVL"
FT                   /protein_id="YP_003165539.1"
FT   misc_feature    complement(308017..309399)
FT                   /note="FAD/FMN-containing dehydrogenases [Energy production
FT                   and conversion]; Region: GlcD; COG0277"
FT                   /db_xref="CDD:30625"
FT                   /locus_tag="CAP2UW1_0253"
FT   misc_feature    complement(308890..309228)
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="CAP2UW1_0253"
FT   gene            309927..310892
FT                   /db_xref="GeneID:8402382"
FT                   /locus_tag="CAP2UW1_0254"
FT   CDS_pept        309927..310892
FT                   /locus_tag="CAP2UW1_0254"
FT                   /gene_family="HOG000274469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: eba:ebA584 glucokinase; TIGRFAM: glucokinase;
FT                   PFAM: Glucokinase"
FT                   /db_xref="GI:257091899"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="GeneID:8402382"
FT                   /translation="MIPGARLVADIGGTHARFALLDERGLPERVRVLAVADYAGPVEAV
FT                   QAYLHEFGSPPLRAAALALAAPVHADVIRMTNADWVFVRADIMARLGLAQLLLLNDFAA
FT                   LALSLPHLAAADLRQVGGGTAVALAPKAVLGPGTGLGVSGVFYARGRWLALTGEGGHCS
FT                   LAPGDRREAEILALAWREFAHVSAERLLSGSGLPLLYRLVGEVDGWSGEPLATPEIVAR
FT                   AVSGDDPRCRAVIDTLCAMLGAMAGNLALTLGAQGGVYVGGGIIPRLGDLFDRSAFRTR
FT                   FEAKGRFASYLVAIPTYVMLCPTPALLGSAHALADSEGCP"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165540.1"
FT   misc_feature    309942..310877
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:186831"
FT                   /locus_tag="CAP2UW1_0254"
FT   gene            310915..313368
FT                   /db_xref="GeneID:8402383"
FT                   /locus_tag="CAP2UW1_0255"
FT   CDS_pept        310915..313368
FT                   /locus_tag="CAP2UW1_0255"
FT                   /gene_family="HOG000278444" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: pna:Pnap_1105 glycogen/starch/alpha-glucan
FT                   phosphorylases; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="GI:257091900"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="GeneID:8402383"
FT                   /translation="MSDSAQPQPESPTLRSQIDRKLLCAVAAEPTRASKADLYQALSFV
FT                   AREKLAQRWVDTQNSDRDDKARRVYYLSMEFLIGRAMNNALSALDLRDQAAAAFSGPGP
FT                   SLDEVMECEPDAALGNGGLGRLAACFLDSMATLGLPSWGYGVRYEYGMFAQSILNGQQV
FT                   EKPEAWLQDRSPWEFPRANKHYTVRFGGTAEHHEEWAEWHAADSVEAKAFDYVIPGHGT
FT                   DRVSTLRLWKAAAPSEIDLGAFNTGDYQRAAEFKNHFENISWVLYPNDSTPAGRELRLR
FT                   QEYFFVSASLQDILVRHLDENGSLANLADKVAIHLNDTHPAIGVAELMRLLIDDHGMSW
FT                   AAAWDQCRRIFSYTNHTLMPEALETWKVTLIQRVLPRHLLIIYRINQEFLDEVVRLYPG
FT                   DIDLMRRVSLIDDGGGHDRDKRVRMANLCIVGSHRVNGVSQLHSDLMVQTIFADFARLY
FT                   PERFHNKTNGVTPRRWLAQANPGLSALLDQRLAGQGWRLDLDRLQDLRATADDAAFRSA
FT                   FAAAKRHNKVRLANYVAREVGISLNPDSLFDVQVKRIHEYKRQLLNVLHVITRYNALLD
FT                   GSASDLAPRSVIFAGKAASSYHMAKQVIRLIHDVAAVVNNDPRTRDLLQVVFIPNYGVS
FT                   VAELIMPAANLSEQISTAGTEASGTGNMKLSLNGALTIGTEDGANIEIRDNVGADNIFI
FT                   FGNNTAQVTAIRQAGHRPMDIYRDDPALKEALDRIDSGFFSPGERPRYHDIFNSLLHYG
FT                   DHYLLLADYADYVATQKRVDALYLNSDEWQRKAILNVAGMGPFSADRTISDYANDTWNI
FT                   RTHTT"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165541.1"
FT   misc_feature    310957..313350
FT                   /note="This is a family of oligosaccharide phosphorylases.
FT                   It includes yeast and mammalian glycogen phosphorylases,
FT                   plant starch/glucan phosphorylase, as well as the
FT                   maltodextrin phosphorylases of bacteria. The members of
FT                   this family catalyze the breakdown of...; Region:
FT                   GT1_Glycogen_Phosphorylase; cd04300"
FT                   /db_xref="CDD:99996"
FT                   /locus_tag="CAP2UW1_0255"
FT   misc_feature    order(310957..310959,310963..310965,310969..310974,
FT                   310978..310986,311053..311061,311452..311454,
FT                   311719..311721,311728..311730)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99996"
FT                   /locus_tag="CAP2UW1_0255"
FT   misc_feature    310966..313350
FT                   /note="glycogen/starch/alpha-glucan phosphorylases; Region:
FT                   P_ylase; TIGR02093"
FT                   /db_xref="CDD:162698"
FT                   /locus_tag="CAP2UW1_0255"
FT   misc_feature    order(311137..311139,311143..311145,311275..311283,
FT                   311713..311715,311722..311724,311728..311730,
FT                   311749..311751,311866..311868,311872..311874,
FT                   311980..311985,311995..311997,312313..312315,
FT                   312334..312336,312568..312573,312577..312588,
FT                   312688..312690,312703..312705,312709..312711,
FT                   312811..312816,312880..312882,312886..312897,
FT                   312904..312906)
FT                   /note="active site pocket"
FT                   /db_xref="CDD:99996"
FT                   /locus_tag="CAP2UW1_0255"
FT   gene            313380..315563
FT                   /db_xref="GeneID:8402384"
FT                   /locus_tag="CAP2UW1_0256"
FT   CDS_pept        313380..315563
FT                   /locus_tag="CAP2UW1_0256"
FT                   /gene_family="HOG000283037" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_1104 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; alpha amylase all-beta; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="GI:257091901"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="GeneID:8402384"
FT                   /translation="MLDTAEIVALCRAEHGDPYAVLGMHVDADGFLWVRSLQPGARSVA
FT                   VLDAKTGRQLAELEHREVEGVEGYFEGLIPRRRISFPYRLRIEWENGVQETDDPYRFAT
FT                   VLGEMDVWLLAEGSHLRPFERLGAHLCEIDGVPGTAFAVWAPDAQRVSVVGDFNTWDGR
FT                   RHPMRLRRECGVWEIFLPGVSAGAHYKYEIRSHGGFLLPLKSDPYGFQAEMRPSTASIV
FT                   CELPPPVDPTSIPAGDLLGAPMSIYEVHLASWRRADDGGFPDWQRISETLIPYVVGLGF
FT                   THIELLPISEHPFDGSWGYQPLGLYSPTARHGSPTGFRNFVGACHAAGLRVMVDWVPAH
FT                   FPTDEHGLGRFDGTALYEHADPREGMHQDWGTLIYNFGRREVSNYLIGNALFWIERYGI
FT                   DGLRVDAVASMLYRDYSREEGQWLPNQYGGRENLEAVAFLRRMNEVLGQEHPAADTHAE
FT                   ESTAWPMVSRPPSMGGLGFHYKWNMGWMHDVLDYMTKDPVHRRYHHNQLSFGMMYAFTE
FT                   NFVLPLSHDEVVHGKGSLLSKMAGDYWQKFANLRSLYAFMWAHPGKKLLFMGGEIGQWN
FT                   EWNHDTSLDWGLLDFPLHAGMHDLIRDLNGIYRSNPALHEVDFEPAGFEWMAPDDADCS
FT                   VVAFVRWSRDHSRAVLYVGNFTPVVRQGYRIGVPVPGGYCERLNTDSQYYGGSNVGNGY
FT                   EPVYAEYVPAHGREWSVSLTLPPLAGLYLEWVP"
FT                   /protein_id="YP_003165542.1"
FT   misc_feature    313383..315560
FT                   /note="glycogen branching enzyme; Provisional; Region:
FT                   PRK05402"
FT                   /db_xref="CDD:180057"
FT                   /locus_tag="CAP2UW1_0256"
FT   misc_feature    313728..314048
FT                   /note="Glycogen branching enzyme N-terminus domain.
FT                   Glycogen branching enzyme (AKA 1,4 alpha glucan branching
FT                   enzyme) catalyzes the formation of alpha-1,6 branch points
FT                   in either glycogen or starch by cleavage of the alpha-1,4
FT                   glucosidic linkage yielding a...; Region:
FT                   Glycogen_branching_enzyme_N_term; cd02855"
FT                   /db_xref="CDD:30342"
FT                   /locus_tag="CAP2UW1_0256"
FT   misc_feature    314124..314570
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="CAP2UW1_0256"
FT   misc_feature    315267..315554
FT                   /note="Alpha amylase, C-terminal all-beta domain; Region:
FT                   Alpha-amylase_C; cl02706"
FT                   /db_xref="CDD:155067"
FT                   /locus_tag="CAP2UW1_0256"
FT   gene            315551..317566
FT                   /db_xref="GeneID:8402385"
FT                   /locus_tag="CAP2UW1_0257"
FT   CDS_pept        315551..317566
FT                   /locus_tag="CAP2UW1_0257"
FT                   /gene_family="HOG000239197" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_1103 glycogen debranching enzyme
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="GI:257091902"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="GeneID:8402385"
FT                   /translation="MGPVIDGMRLQAGRPWPLGAHWDGRGVNFALFSAHAEAVELCLFE
FT                   GGQMRALHLEQCTDQVWHGYLAGAAPGLCYAYRVHGPSAPDRGHRFDARHLLLDPYARE
FT                   VVGRFSWPAQDDPAHRLKACVVDEHFDWGGDAPLAVPWADTVLYEVHVKGISCQHPGVP
FT                   EALRGTYAGLAAPAMIEHYRRLGVTALSLLPVHHFLDEQRLVNEGRVNYWGYNSLAFFA
FT                   PEPRYAARIGGQSVIAEFKTMVCALHAAGIEVILDVVFNHTAETDEAGPTLSFRGIDNL
FT                   SYYRLPAGNLASYENFTGCGNTLNLANARVLQMVMDSLRYWVEVMHVDGFRFDLAATLT
FT                   RDSAFLAAKRQDPVLQRVKLIAEPWDVGPDGYHLGRFLPGWSEWNDRFRDDVRAFWLTG
FT                   GVGVAALAQRLAGSSEVFRFAGRAPQAGVNFITAHDGFTLRDLVSYQEKHNELNGEGNR
FT                   DGHSHNLSWNCGEEGESRDPAVLERRRRLQRALLTTLLISQGVPMLQSGDEIGRTQAGN
FT                   NNAYCQDNAMTWLDWRSADADLVAFVAGLIGLRQRFRQLRRRRWLTGEGNAEGQPDVVW
FT                   WHPAGRPMRVADWQSGKLGALGLQLAPETSTDGQADDHRILLCLINRDEIPVSFLLPAG
FT                   VWWQVCDSSAQSPFAACQRERTSTLPARSVQILCLG"
FT                   /protein_id="YP_003165543.1"
FT   misc_feature    315584..317545
FT                   /note="glycogen debranching enzyme GlgX; Region:
FT                   glgX_debranch; TIGR02100"
FT                   /db_xref="CDD:131155"
FT                   /locus_tag="CAP2UW1_0257"
FT   misc_feature    315599..315883
FT                   /note="Glycogen_debranching_enzyme N-terminal domain.
FT                   Glycogen debranching enzymes have both
FT                   4-alpha-glucanotransferase and amylo-1,6-glucosidase
FT                   activities. As a transferase it transfers a segment of a
FT                   1,4-alpha-D-glucan to a new 4-position in an acceptor...;
FT                   Region: Glycogen_debranching_enzyme_N_term; cd02856"
FT                   /db_xref="CDD:30343"
FT                   /locus_tag="CAP2UW1_0257"
FT   misc_feature    316103..>316558
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="CAP2UW1_0257"
FT   gene            complement(317608..318576)
FT                   /db_xref="GeneID:8402386"
FT                   /locus_tag="CAP2UW1_0258"
FT   CDS_pept        complement(317608..318576)
FT                   /locus_tag="CAP2UW1_0258"
FT                   /gene_family="HOG000137832" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamine monophosphate synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; thiamine monophosphate
FT                   synthase; KEGG: dar:Daro_3706 hypothetical protein"
FT                   /db_xref="GI:257091903"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="GeneID:8402386"
FT                   /translation="MNVVGEGATPITEVAAAVLLRGDPATPEFLLAQRPVGKVYAGYWE
FT                   FPGGKVEAGETTRAALVRELQEELGVTVDQAWPWVCCEFTYPHARVRLRFFRVTSWHGE
FT                   IAPIEHSGFVWSKVGAAASVAPILPANGPILRALALPPVYALSHAEERGVEAELTRLAH
FT                   ALSSGLRLIQVRDKTLPRAQRRHFAHMVVTLARGFAGACVLVNDDPELARTVSADGLHL
FT                   SSRRLWEIDRRPDFDRVAASCHTPADLARAVELGLDFVVLGPVLPTASHPEARAMGWEQ
FT                   FSRLLEHSPLPVYALGGLQPNMLDTARRHGGHGIALMRGWR"
FT                   /protein_id="YP_003165544.1"
FT   misc_feature    complement(317614..318555)
FT                   /note="hypothetical protein; Provisional; Region: PRK08999"
FT                   /db_xref="CDD:181607"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(318160..318540)
FT                   /note="The MutT pyrophosphohydrolase is a prototypical
FT                   Nudix hydrolase that catalyzes the hydrolysis of nucleoside
FT                   and deoxynucleoside triphosphates (NTPs and dNTPs) by
FT                   substitution at a beta-phosphorus to yield a nucleotide
FT                   monophosphate (NMP) and inorganic...; Region:
FT                   MutT_pyrophosphohydrolase; cd03425"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(order(318184..318186,318250..318252,
FT                   318304..318306,318373..318378,318385..318387,
FT                   318421..318423,318427..318432,318535..318537))
FT                   /note="active site"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(order(318184..318186,318304..318306,
FT                   318310..318312,318427..318432,318535..318537))
FT                   /note="8-oxo-dGMP binding site; other site"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(318364..318432)
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(order(318373..318378,318385..318387))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(317617..318129)
FT                   /note="Thiamine monophosphate synthase (TMP synthase)/TenI.
FT                   TMP synthase catalyzes an important step in the thiamine
FT                   biosynthesis pathway, the substitution of the pyrophosphate
FT                   of 2-methyl-4-amino-5- hydroxymethylpyrimidine
FT                   pyrophosphate by 4-methyl-5- (beta-...; Region: TMP_TenI;
FT                   cd00564"
FT                   /db_xref="CDD:73367"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(order(317620..317625,317683..317685,
FT                   317764..317769,317773..317775,317851..317853,
FT                   317899..317901,317956..317961,318046..318048,
FT                   318052..318054,318058..318060))
FT                   /note="active site"
FT                   /db_xref="CDD:73367"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(order(317620..317631,317683..317685,
FT                   317695..317697,317767..317769,317773..317775,
FT                   317794..317796,317800..317802,317851..317853,
FT                   317914..317916,318052..318054,318058..318060))
FT                   /note="thiamine phosphate binding site; other site"
FT                   /db_xref="CDD:73367"
FT                   /locus_tag="CAP2UW1_0258"
FT   misc_feature    complement(order(317764..317766,317851..317853,
FT                   317899..317901,317908..317910,317956..317961,
FT                   318046..318048,318052..318054))
FT                   /note="pyrophosphate binding site; other site"
FT                   /db_xref="CDD:73367"
FT                   /locus_tag="CAP2UW1_0258"
FT   gene            complement(318614..319579)
FT                   /db_xref="GeneID:8402387"
FT                   /locus_tag="CAP2UW1_0259"
FT   CDS_pept        complement(318614..319579)
FT                   /locus_tag="CAP2UW1_0259"
FT                   /gene_family="HOG000255906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF815"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF815; SMART: AAA
FT                   ATPase; KEGG: eba:ebA4101 predicted AAA ATPase superfamily"
FT                   /db_xref="GI:257091904"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="GeneID:8402387"
FT                   /translation="MSDPFRQLASFLARAEQLLERIEPLLPPASPLPEWHLASAFRWRT
FT                   RRGVGYLQPIARLPAIRLADLQDIDEQKARIDTNTRHFVAGQPANNVLLTGARGSGKSS
FT                   LIKALLNEYAANGLRVIEVEKGDLTDLPDIVELTEGRPERFIIFCDDLSFDAGDARYKA
FT                   LKVVLDGSLAAPPENVLIYATSNRRHLMPEYFAENLESRRVGEEIHPGEAIEEKISLSE
FT                   RFGLWISFYPFDQDAYLNIVAHWLKAFGCRHDDIAAAERDALNWALERGSRSGRVAWQF
FT                   ARDWAGRHSGVLPVRPRRQRTKAAPTDAASATRKRPGNAP"
FT                   /protein_id="YP_003165545.1"
FT   misc_feature    complement(318698..319558)
FT                   /note="Predicted ATPase (AAA+ superfamily) [General
FT                   function prediction only]; Region: COG2607"
FT                   /db_xref="CDD:32599"
FT                   /locus_tag="CAP2UW1_0259"
FT   misc_feature    complement(318974..319339)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0259"
FT   misc_feature    complement(319271..319294)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0259"
FT   misc_feature    complement(order(319022..319024,319130..319132,
FT                   319268..319291))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0259"
FT   misc_feature    complement(319127..319144)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0259"
FT   misc_feature    complement(318974..318976)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="CAP2UW1_0259"
FT   gene            319629..320879
FT                   /db_xref="GeneID:8402388"
FT                   /locus_tag="CAP2UW1_0260"
FT   CDS_pept        319629..320879
FT                   /locus_tag="CAP2UW1_0260"
FT                   /gene_family="HOG000255816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MltA domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MltA domain protein; 3D domain protein; KEGG:
FT                   eba:ebA4100 membrane-bound lytic murein transglycosylase A"
FT                   /db_xref="GI:257091905"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="GeneID:8402388"
FT                   /translation="MPKSQSRRLLATALLTALLTACGGTNGTREVPAACPACPACPPCG
FT                   TQAQPAATTTSPPSARLLQAARWSELPGWGDDDLAAAWPAFLLSCRALASRPQWPQWKT
FT                   ACDEAKGLTSPSTTTIRRFLEARLQPWLLTNSDGSTGGLVTGYYEPLLRGARTRGKPYL
FT                   QPVLGVPTDLLTIDLGAVLPELKNMRLRGRLDGNKVVPYYSRAEITSREKDSPDRALLW
FT                   VDDPVELFFLQVQGSGRVKLPDGSMTRLAYADQNGHPYQSIGRVLVDRGELTLDQVSMQ
FT                   GIKQWARANPARVGELLNANPSYVFFREQAIKSGQNGAAEGPSGALGVPLTPERSIAVD
FT                   PRHVPLGAPVFLSTSLPASTTPLRRLVLAQDTGGAIRGVVRADLFWGFGAQAGMQAGRM
FT                   KQQGQMWVLLPPGAAPE"
FT                   /protein_id="YP_003165546.1"
FT   sig_peptide     319629..319700
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.588 at
FT                   residue 24"
FT                   /locus_tag="CAP2UW1_0260"
FT   misc_feature    319809..320876
FT                   /note="Membrane-bound lytic murein transglycosylase [Cell
FT                   envelope biogenesis, outer membrane]; Region: MltA;
FT                   COG2821"
FT                   /db_xref="CDD:32649"
FT                   /locus_tag="CAP2UW1_0260"
FT   misc_feature    <320286..320552
FT                   /note="MltA specific insert domain; Region: MltA;
FT                   pfam03562"
FT                   /db_xref="CDD:146283"
FT                   /locus_tag="CAP2UW1_0260"
FT   misc_feature    320631..320855
FT                   /note="3D domain; Region: 3D; cl01439"
FT                   /db_xref="CDD:154402"
FT                   /locus_tag="CAP2UW1_0260"
FT   gene            321055..322257
FT                   /db_xref="GeneID:8402389"
FT                   /locus_tag="CAP2UW1_0261"
FT   CDS_pept        321055..322257
FT                   /locus_tag="CAP2UW1_0261"
FT                   /gene_family="HOG000017735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rh family protein/ammonium transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Rh family protein/ammonium transporter; KEGG:
FT                   dar:Daro_3703 Rh-like protein/ammonium transporter"
FT                   /db_xref="GI:257091906"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR010256"
FT                   /db_xref="GeneID:8402389"
FT                   /translation="MEALKSGSDVLFILLGGIMVLAMHSGFAFLELGTVRKKSQVNALV
FT                   KILTDFSVSTIAYFFVGYSIAYGVNFFAGAETLVQKNGFELTKFFFLLTFAAAIPAIVS
FT                   GGIAERARFYPQLAATFLIVGFIYPLFEGIAWNQAFGVQAWLKANYGEEFHDFAGSVVV
FT                   HAMGGWIALPAVVLLGARYGRYTKEGRVSAHPPSSIPFLALGAWILTVGWFGFNVMSAQ
FT                   TIDKISGLVAMNSLMAMVGGTLVAMVAGRNDPGFVHNGPLAGLVAVCAGSDVMHPIGAL
FT                   IVGGVAGGMFVMMFTLTQNRWKIDDVLGVWPLHGLCGAWGGIAAGIFGSKALGGIGGVA
FT                   LMPQLLMTGMAIAIALIGSCLVYGLLKGAVGLRLDQEQEYNGADLSIHKITATPERETN
FT                   W"
FT                   /protein_id="YP_003165547.1"
FT   sig_peptide     321055..321141
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.329 at
FT                   residue 29"
FT                   /locus_tag="CAP2UW1_0261"
FT   misc_feature    321073..322248
FT                   /note="Ammonium Transporter Family; Region:
FT                   Ammonium_transp; cl03012"
FT                   /db_xref="CDD:186546"
FT                   /locus_tag="CAP2UW1_0261"
FT   gene            322363..323874
FT                   /db_xref="GeneID:8402390"
FT                   /locus_tag="CAP2UW1_0262"
FT   CDS_pept        322363..323874
FT                   /locus_tag="CAP2UW1_0262"
FT                   /gene_family="HOG000046975" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: dar:Daro_4123 threonine dehydratase"
FT                   /db_xref="GI:257091907"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="GeneID:8402390"
FT                   /translation="MHTDYLERILNARVYDVAIETPLDFAPGLSARIGNRVLLKREDLQ
FT                   PVFSFKLRGAYNKIVHLSKEKLKRGVICASAGNHAQGVALAANKVGCRAVIVMPTTTPQ
FT                   IKVQAVQARGAEVILAGESYDDAYTHALELEKTEKLTFVHPFDDPEVIAGQGTIGMEIL
FT                   RQHAQPIHAVFCCVGGGGLISGVAAYIKRLRPETRIIGVEAADADAMARSLNAGKRVRL
FT                   EHVGLFADGAAVKYVGEETFRLCQMYVDEMVLVDTDAICAAIKDVFEDTRAVLEPAGAL
FT                   AVAGAKAYAASHRLKDRTLVATASGANLNFDRLRFVAERAEIGEQREAVFAVTLPEKPG
FT                   AYRQFLSLIGARNVTEFNYRYNDQRAAHIFVGVQVASRAESVRLLDHLRRHDYPTLDLT
FT                   DDEMAKGHVRHLVGGRSPQITNEIVYRFEFPERPGALMNFLNRMSAGWNISLFHYRNHG
FT                   ADYGRVLVGMQVPPDELDDFEVFLKTLGYAHWNETDNPAYRLFLA"
FT                   /protein_id="YP_003165548.1"
FT   misc_feature    322363..323871
FT                   /note="threonine dehydratase; Reviewed; Region: PRK09224"
FT                   /db_xref="CDD:181709"
FT                   /locus_tag="CAP2UW1_0262"
FT   misc_feature    322378..323292
FT                   /note="Threonine dehydratase: The first step in amino acid
FT                   degradation is the removal of nitrogen. Although the
FT                   nitrogen atoms of most amino acids are transferred to
FT                   alpha-ketoglutarate before removal, the alpha-amino group
FT                   of threonine can be directly...; Region: Thr-dehyd;
FT                   cd01562"
FT                   /db_xref="CDD:107205"
FT                   /locus_tag="CAP2UW1_0262"
FT   misc_feature    order(322378..322383,322390..322392,322399..322404,
FT                   322489..322494,322933..322938,323143..323145,
FT                   323152..323157,323164..323166,323176..323184,
FT                   323281..323292)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:107205"
FT                   /locus_tag="CAP2UW1_0262"
FT   misc_feature    order(322513..322515,322594..322596,322894..322908,
FT                   323275..323277)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:107205"
FT                   /locus_tag="CAP2UW1_0262"
FT   misc_feature    322513..322515
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:107205"
FT                   /locus_tag="CAP2UW1_0262"
FT   misc_feature    323344..323595
FT                   /note="First of two tandem C-terminal ACT domains of
FT                   threonine dehydratase I (ThrD-I; L-threonine hydrolyase);
FT                   Region: ACT_ThrD-I_1; cd04906"
FT                   /db_xref="CDD:153178"
FT                   /locus_tag="CAP2UW1_0262"
FT   misc_feature    323380..323397
FT                   /note="putative Ile/Val binding site; other site"
FT                   /db_xref="CDD:153178"
FT                   /locus_tag="CAP2UW1_0262"
FT   misc_feature    323626..323868
FT                   /note="Second of two tandem C-terminal ACT domains of
FT                   threonine dehydratase I (ThrD-I; L-threonine hydrolyase);
FT                   Region: ACT_ThrD-I_2; cd04907"
FT                   /db_xref="CDD:153179"
FT                   /locus_tag="CAP2UW1_0262"
FT   misc_feature    323662..323679
FT                   /note="putative Ile/Val binding site; other site"
FT                   /db_xref="CDD:153179"
FT                   /locus_tag="CAP2UW1_0262"
FT   gene            complement(323963..324595)
FT                   /db_xref="GeneID:8402391"
FT                   /locus_tag="CAP2UW1_0263"
FT   CDS_pept        complement(323963..324595)
FT                   /locus_tag="CAP2UW1_0263"
FT                   /gene_family="HOG000007299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   dar:Daro_4131 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="GI:257091908"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="GeneID:8402391"
FT                   /translation="MAPDLAPGIRPGSSSGSDPGERRALRRALLERRLALPTADWASYS
FT                   SRVCAHLEAGFPQLATMAVGFCWPQKQEPDLRPLIERWAVAARKGFRALLPVVLAENRP
FT                   LAFRAWSPDTVMLADRYGIPTPATGEFLIPEALLLPVNGFDAAGYRIGYGGGYFDRTLA
FT                   ALHPRPLAIGVGFELARLDSIGPEPHDQVLDAMVTEAGLFRPARPTT"
FT                   /protein_id="YP_003165549.1"
FT   misc_feature    complement(323999..324487)
FT                   /note="5-formyltetrahydrofolate cyclo-ligase family;
FT                   Region: 5-FTHF_cyc-lig; cl00360"
FT                   /db_xref="CDD:185939"
FT                   /locus_tag="CAP2UW1_0263"
FT   gene            324639..326582
FT                   /db_xref="GeneID:8402392"
FT                   /locus_tag="CAP2UW1_0264"
FT   CDS_pept        324639..326582
FT                   /locus_tag="CAP2UW1_0264"
FT                   /gene_family="HOG000265691" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   dar:Daro_4132 lytic transglycosylase, catalytic"
FT                   /db_xref="GI:257091909"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="GeneID:8402392"
FT                   /translation="MKHRYTVFGLFISLLGVHLAALALTADEQFLAARDAFRAGDKARL
FT                   ERLASTPPGYELEAYVDYWRLLLDLKDTDATSVAAFLARHENTYVGERLRVDWLRLQGK
FT                   RQQWAAFDVEYPRLAQPDQDLACYALQSRRAQGDASALDDALPLWLTLIEPPEPCYPLL
FT                   EALIVEKRVLADAVWARIRRQFEANKIAAAIYSMNYLPPSQTPDKKVAQMVADAPLPWL
FT                   TRLPSDLAGSRMQRELAVLAIQRVARNDPRMAADQLSRISASLNAGEKAWAWGQIGWQA
FT                   AQRHLPEAMEWYRQAGEAPLSDEVAQWKVRAALRVHDWGSVRATIEKMPPALAAQPAWV
FT                   YWLGRAYRAGGRLDEANALFAKIAGQPDFYGNLANDELGRTTTTPPKASPPSREELLQV
FT                   TANPGVQRALAFFRLNLRTEGVKEWNWSLRGMSDRELLAASDIAQRAGMYDRAIAAADR
FT                   TRTEHDYSLRYLAPYADQVRPAARNQVLDDAWVYGLMRQESRFVTSARSSVGASGLMQL
FT                   MPATAKWVANKIGLKDFQQSRVNDTETNVLLGTTYMRLVLESLDNHPVLASAAYNAGPG
FT                   RARRWRADRPMEGAIYAETIPFNETRDYVKKVMSNSVYYAALFDGKPQTIKSRLGVIAP
FT                   RTGGEAKGEDLP"
FT                   /protein_id="YP_003165550.1"
FT   sig_peptide     324639..324710
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.699 at
FT                   residue 24"
FT                   /locus_tag="CAP2UW1_0264"
FT   misc_feature    324672..326516
FT                   /note="lytic murein transglycosylase; Provisional; Region:
FT                   PRK11619"
FT                   /db_xref="CDD:183236"
FT                   /locus_tag="CAP2UW1_0264"
FT   misc_feature    326103..326471
FT                   /note="Lytic Transglycosylase (LT)  and Goose Egg White
FT                   Lysozyme (GEWL) domain. Members include the soluble and
FT                   insoluble membrane-bound LTs in bacteria, the LTs in
FT                   bacteriophage lambda, as well as, the eukaryotic
FT                   'goose-type' lysozymes (GEWL).  LTs catalyze...; Region:
FT                   LT_GEWL; cd00254"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="CAP2UW1_0264"
FT   misc_feature    order(326130..326132,326190..326192,326292..326294,
FT                   326349..326351)
FT                   /note="N-acetyl-D-glucosamine binding site; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="CAP2UW1_0264"
FT   misc_feature    326130..326132
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29556"
FT                   /locus_tag="CAP2UW1_0264"
FT   gene            326623..327588
FT                   /db_xref="GeneID:8402393"
FT                   /locus_tag="CAP2UW1_0265"
FT   CDS_pept        326623..327588
FT                   /locus_tag="CAP2UW1_0265"
FT                   /gene_family="HOG000168008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADH dehydrogenase (ubiquinone)"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: dar:Daro_4134 NAD-dependent
FT                   epimerase/dehydratase:3-beta hydroxysteroid
FT                   dehydrogenase/isomerase:dTDP-4-dehydrorhamnose
FT                   reductase:NmrA-like"
FT                   /db_xref="GI:257091910"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:8402393"
FT                   /translation="MELENVLLIGGSGFVGGWIASCLSERGVRVTIPTRRRENTKKLIM
FT                   LPTVSMVEANIHDPQVLAQLVQGHDAVINLVGVLHDTDSRLPYGRGFQAAHVDLPKKII
FT                   AAMRENGVRRLVHMSALRAGINAPSEYLRSKGDGEAAVRSAMNELDVTMFRPSVIFGPD
FT                   DAFLNMFAKLLRLFPVLPLGGGSARFQPVYVGDVARAFADSLTNGATFGQTYELCGPKV
FT                   YTLREMVDYTAHLVGKQRRVIDLGTGGWAYLQAGLMWLLPNPPLSPDNLRSMELDSVTD
FT                   GSHDYPGWQPTPLEAVAPGYLSPDEMIQLRLDRYRYRAGR"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165551.1"
FT   misc_feature    326638..327258
FT                   /note="NAD dependent epimerase/dehydratase family; Region:
FT                   Epimerase; pfam01370"
FT                   /db_xref="CDD:144821"
FT                   /locus_tag="CAP2UW1_0265"
FT   misc_feature    326638..>327108
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0265"
FT   misc_feature    <327004..327222
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0265"
FT   gene            327627..328874
FT                   /db_xref="GeneID:8402394"
FT                   /locus_tag="CAP2UW1_0266"
FT   CDS_pept        327627..328874
FT                   /locus_tag="CAP2UW1_0266"
FT                   /gene_family="HOG000007368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   dar:Daro_4135 metal dependent phosphohydrolase"
FT                   /db_xref="GI:257091911"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:8402394"
FT                   /translation="MQIFTVGGAVRDELLGLPVKDRDYVVVGASPEEMLARGFRPVGKD
FT                   FPVFLHPSTHEEYALARTERKTGPGYRGFAFRAAPEVSLAEDLARRDLTINAIARAADG
FT                   SLLDPYHGIDDLSRRVLRHVGPAFVEDPVRVLRIARFAARFSDFVVAPETVALMRLMVA
FT                   GGELDHLVAERVWQEVARGLMETRPSRMFEILRECGALARLLPELDRLWGVPQRADYHP
FT                   EVDTGIHVMMVIDQSAQRSCALPVRFAVLVHDLGKGTTPDGDLPRHPGHEERSVELVGQ
FT                   VCVRLKVPVECRDLAVLVARHHGKVHRAAELGAAAIVRLLEATDAVRRPGRFEQLLEAC
FT                   ACDYHGRLGWQEIAYTAPALLRQALAQAGAVDAAAIVRGCTDPASIPARLHEARVAAVR
FT                   QGLSAGLATAGALGLR"
FT                   /protein_id="YP_003165552.1"
FT   misc_feature    327627..328826
FT                   /note="multifunctional tRNA nucleotidyl
FT                   transferase/2'3'-cyclic
FT                   phosphodiesterase/2'nucleotidase/phosphatase; Reviewed;
FT                   Region: cca; PRK10885"
FT                   /db_xref="CDD:182810"
FT                   /locus_tag="CAP2UW1_0266"
FT   misc_feature    327627..327980
FT                   /note="Nucleotidyltransferase (NT) domain of ClassII
FT                   CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398"
FT                   /db_xref="CDD:143388"
FT                   /locus_tag="CAP2UW1_0266"
FT   misc_feature    order(327645..327650,327657..327662,327687..327689,
FT                   327693..327695,327795..327797,327810..327812,
FT                   327894..327905,327912..327914)
FT                   /note="active site"
FT                   /db_xref="CDD:143388"
FT                   /locus_tag="CAP2UW1_0266"
FT   misc_feature    order(327645..327650,327657..327659,327687..327689,
FT                   327693..327695,327894..327902,327912..327914)
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143388"
FT                   /locus_tag="CAP2UW1_0266"
FT   misc_feature    order(327687..327689,327693..327695,327795..327797)
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143388"
FT                   /locus_tag="CAP2UW1_0266"
FT   gene            complement(328871..330055)
FT                   /db_xref="GeneID:8402395"
FT                   /locus_tag="CAP2UW1_0267"
FT   CDS_pept        complement(328871..330055)
FT                   /locus_tag="CAP2UW1_0267"
FT                   /gene_family="HOG000265464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF185"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   dar:Daro_4140 protein of unknown function DUF185"
FT                   /db_xref="GI:257091912"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="GeneID:8402395"
FT                   /translation="MLSHASQAALSLPLPTADGLAFSRALSQHISTEIAAGDGWIGFDR
FT                   FMSLALYAPGMGYYSGGAHKFGPAGDFVTAPEICPAFAQTLGAQAAQILVLSAPRIIEV
FT                   GAGTGEFAADLLLELERRGALPDSYAILDLSGELRARQQATLARRTPHLLPRVRWLERL
FT                   PERFDGLVLANEVLDAMPAHLVLWGPTHIAERGVGVDEGRFVWRDRPASGPLLGRAKVL
FT                   AGECEIAPGYLSEISLTAPAWITEWAGILGQGALLLIDYGFPRHEYYHPQRSAGTLMCH
FT                   YRHRSHTDPFYLPGLQDITTHVDFTGIVEAGCQAGLELLGYTTQSSFLFNCGLTEILSR
FT                   TPVGDALRYLPLANAVQKLVSPAEMGEIFKVIALGKGISQPLLGFATGDRSATL"
FT                   /protein_id="YP_003165553.1"
FT   misc_feature    complement(328889..329959)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG1565"
FT                   /db_xref="CDD:31753"
FT                   /locus_tag="CAP2UW1_0267"
FT   misc_feature    complement(329087..329803)
FT                   /note="Uncharacterized ACR, COG1565; Region: DUF185;
FT                   pfam02636"
FT                   /db_xref="CDD:145672"
FT                   /locus_tag="CAP2UW1_0267"
FT   gene            complement(330116..330964)
FT                   /db_xref="GeneID:8402396"
FT                   /locus_tag="CAP2UW1_0268"
FT   CDS_pept        complement(330116..330964)
FT                   /locus_tag="CAP2UW1_0268"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091913"
FT                   /db_xref="GeneID:8402396"
FT                   /translation="MSKPDQPLDADELMDLAERAAQLPATEAEWVGRLFQEVLRARTHE
FT                   TELQAQQVSAPREAQPSGDELDDRLVQVAIDTAEWLRTLWDVGYMGAGSFRSQPRSAFP
FT                   SIDLEDIRKSSLFARIRQGKHALPFPPPTRQGLPWHALLDDNGQTHAVTAEVIRDGVGP
FT                   PLGAIIEGCAEWDVIEEVVDGQEYVVQHQGKGPTYRLCVSGAATAELCREPPTSTRTIH
FT                   LEGRSGFHSYTLEWPEADGSQIFVTLRAATWERAESEAERWLANTHPELYGQIRFERCE
FT                   D"
FT                   /protein_id="YP_003165554.1"
FT   gene            331099..331836
FT                   /db_xref="GeneID:8402397"
FT                   /locus_tag="CAP2UW1_0269"
FT   CDS_pept        331099..331836
FT                   /locus_tag="CAP2UW1_0269"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   azo:azo0486 pteridine reductase"
FT                   /db_xref="GI:257091914"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR002424"
FT                   /db_xref="GeneID:8402397"
FT                   /translation="MEGKTILVTGAARRLGSAVAREMHTAGARVMLHYRKASGEAEALV
FT                   AELNALRPDSAACVQADLLAIDTLPQLVADTVARFGSLDALVNNASSFFSTRFGSIDPA
FT                   AWDDLVGTNFKAPLFLTQAAAPHLLAAHGAVVNITDIHAERPLAGYSLYCAAKAALLGL
FT                   TRALAIELAPRVRVNAVAPGPILWPETGAFDSAARAEIVAHTLLQRPGSPQDIARAVRY
FT                   LLVDAVYVTGQVINVDGGRTAHL"
FT                   /protein_id="YP_003165555.1"
FT   misc_feature    331099..331833
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="CAP2UW1_0269"
FT   misc_feature    331099..331830
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05557"
FT                   /db_xref="CDD:180126"
FT                   /locus_tag="CAP2UW1_0269"
FT   gene            331863..332747
FT                   /db_xref="GeneID:8402398"
FT                   /locus_tag="CAP2UW1_0270"
FT   CDS_pept        331863..332747
FT                   /locus_tag="CAP2UW1_0270"
FT                   /gene_family="HOG000013323" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PP-loop domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PP-loop domain protein; KEGG: dar:Daro_4143
FT                   PP-loop"
FT                   /db_xref="GI:257091915"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="GeneID:8402398"
FT                   /translation="MQLSNTLLRLKKRLESNVGKAIADYGMIEDGDTVLVCVSGGKDSH
FT                   TLLSLLIALRERAPVNFRVIAMNLDQKQPGFPAEVLPDYLAKIGVDYRIVEQDTYAVVK
FT                   DKIPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVHTLFLNLFFGGQLKAM
FT                   PPKLRTDDGCHVVIRPLAYCRESDIARFARGMEYPIIPCNLCGSQDNLQRQKIREMMAD
FT                   WDQRYPGRTDVVFSALQKVVPSHLADQTLFDFKGLRVGGETVPAAADALFDAPWFGTPP
FT                   HTSHVFPLQVAKA"
FT                   /protein_id="YP_003165556.1"
FT   misc_feature    331872..332642
FT                   /note="tRNA 2-thiocytidine biosynthesis protein TtcA;
FT                   Provisional; Region: PRK10696"
FT                   /db_xref="CDD:182655"
FT                   /locus_tag="CAP2UW1_0270"
FT   misc_feature    331962..332486
FT                   /note="This is a subfamily of Adenine nucleotide alpha
FT                   hydrolases superfamily.Adeninosine nucleotide alpha
FT                   hydrolases superfamily  includes N type ATP PPases and ATP
FT                   sulphurylases. It forms a apha/beta/apha fold which  binds
FT                   to Adenosine group.  This...; Region: Alpha_ANH_like_II;
FT                   cd01993"
FT                   /db_xref="CDD:30180"
FT                   /locus_tag="CAP2UW1_0270"
FT   misc_feature    order(331971..331979,331983..331994,332064..332066,
FT                   332070..332072)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30180"
FT                   /locus_tag="CAP2UW1_0270"
FT   gene            332818..333708
FT                   /db_xref="GeneID:8402399"
FT                   /locus_tag="CAP2UW1_0271"
FT   CDS_pept        332818..333708
FT                   /locus_tag="CAP2UW1_0271"
FT                   /gene_family="HOG000009149" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FHA domain containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   dar:Daro_4144 forkhead-associated"
FT                   /db_xref="GI:257091916"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="GeneID:8402399"
FT                   /translation="MSSEEGMLSALFVSVSGSARLFDKLGGAEALHAVDRCMKRVLRGV
FT                   DGFRGRIVRTTRDDITALFEHADDACQAAIAMQRRIADLPPVSGVKLAIRAGFHHGEVI
FT                   GEGVGGCVNTAECLAGLAKPGQVLATAETQALLSVPLQSSTRCLDSLSVKGQFTDQRVF
FT                   EVLWLEPRNPGYRAIVESAAEAPSERDPRLCLRYAGQVKLLDRIRPKLLMGRDSGCDVT
FT                   VRDRRASRHHARIERRGDFFVLSDLSTNGTFVTISGGPELLVRREEFVLRGSGIISFAA
FT                   SASSPGADIAEFEYL"
FT                   /protein_id="YP_003165557.1"
FT   misc_feature    332839..333312
FT                   /note="cyclase homology domain; Region: CHD; cd07302"
FT                   /db_xref="CDD:143636"
FT                   /locus_tag="CAP2UW1_0271"
FT   misc_feature    order(332851..332853,332857..332874,332977..332979,
FT                   332983..332991,332998..333000,333133..333141,
FT                   333151..333156,333163..333168,333277..333279)
FT                   /note="nucleotidyl binding site; other site"
FT                   /db_xref="CDD:143636"
FT                   /locus_tag="CAP2UW1_0271"
FT   misc_feature    order(332857..332859,332989..332991)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143636"
FT                   /locus_tag="CAP2UW1_0271"
FT   misc_feature    order(332872..332874,332908..332910,332917..332922,
FT                   332929..332931,332941..332943,332977..332982,
FT                   333106..333108,333136..333147,333154..333156,
FT                   333277..333279)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:143636"
FT                   /locus_tag="CAP2UW1_0271"
FT   misc_feature    <333451..>333579
FT                   /note="Forkhead associated domain (FHA); found in
FT                   eukaryotic and prokaryotic proteins. Putative nuclear
FT                   signalling domain. FHA domains may bind phosphothreonine,
FT                   phosphoserine and sometimes phosphotyrosine. In eukaryotes,
FT                   many FHA domain-containing proteins...; Region: FHA;
FT                   cd00060"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="CAP2UW1_0271"
FT   misc_feature    order(333460..333462,333496..333498,333502..333507,
FT                   333562..333570)
FT                   /note="phosphopeptide binding site; other site"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="CAP2UW1_0271"
FT   gene            complement(333806..334513)
FT                   /db_xref="GeneID:8402400"
FT                   /locus_tag="CAP2UW1_0272"
FT   CDS_pept        complement(333806..334513)
FT                   /locus_tag="CAP2UW1_0272"
FT                   /gene_family="HOG000075040" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: dar:Daro_0617 phosphoribosyltransferase"
FT                   /db_xref="GI:257091917"
FT                   /db_xref="InterPro:IPR002375"
FT                   /db_xref="GeneID:8402400"
FT                   /translation="MTILTQSAELVRRSCKRLLPQDCLLCGAASGTTLLCPACATDLPR
FT                   LPATRCPLCALPTPGGSVCGRCLTAPPHYDATLAVYRYAFPIDKLVQAFKYGHRLALGA
FT                   WFGSRLAELAKDFHADLIVPMPLHRLRLRERGFNQALELARAVSRCSRIPIDARTCTRI
FT                   RQTATQADLPWRERAGNVRGAFHCATDLTGKRLVLVDDVMTTGASLNELARTVKLHGAV
FT                   EVTLLTLARALPS"
FT                   /protein_id="YP_003165558.1"
FT   sig_peptide     complement(334391..334513)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.758) with cleavage site probability 0.752 at
FT                   residue 41"
FT                   /locus_tag="CAP2UW1_0272"
FT   misc_feature    complement(333812..334483)
FT                   /note="Predicted amidophosphoribosyltransferases [General
FT                   function prediction only]; Region: ComFC; COG1040"
FT                   /db_xref="CDD:31242"
FT                   /locus_tag="CAP2UW1_0272"
FT   misc_feature    complement(333815..334411)
FT                   /note="Phosphoribosyl transferase domain; Region:
FT                   Pribosyltran; cl00309"
FT                   /db_xref="CDD:185893"
FT                   /locus_tag="CAP2UW1_0272"
FT   gene            334580..335569
FT                   /db_xref="GeneID:8402401"
FT                   /locus_tag="CAP2UW1_0273"
FT   CDS_pept        334580..335569
FT                   /locus_tag="CAP2UW1_0273"
FT                   /gene_family="HOG000239957" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: dar:Daro_0618 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: Radical SAM domain protein; biotin and
FT                   thiamin synthesis associated; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="GI:257091918"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="GeneID:8402401"
FT                   /translation="MNAIPQAATLAQDCSPTTHSARWTVAEVEALYQLPLMDLIYRAQQ
FT                   VHRENFDANAIQRSTLLSVKTGGCSEDCGYCSQAARYTTGTEREALLPLDEVIAAAQAA
FT                   KDKGASRFCMGAAWRGPKDKDLAKVTEMIRAVKGLGLQTCVTLGMLKEGQADELKEAGL
FT                   DYYNHNLDTDASFYGQVITTHKHADRIDTLGQVREAGLKVCSGGIIGMGESRRNRAALI
FT                   VQLANLNPPPESVPINNLVPIPGTPMAALAPIDNFEFVRTIAAARITMPASFVRLSAGR
FT                   QAMAEELQALCFLAGANSIFYGDKLLTTGNPEADRDEALFEKLGLRPI"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165559.1"
FT   misc_feature    334631..335563
FT                   /note="biotin synthase; Provisional; Region: PRK15108"
FT                   /db_xref="CDD:185063"
FT                   /locus_tag="CAP2UW1_0273"
FT   misc_feature    334775..335377
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="CAP2UW1_0273"
FT   misc_feature    order(334784..334786,334790..334792,334796..334798,
FT                   334802..334810,334922..334924,334928..334933,
FT                   335009..335017,335084..335086,335201..335203,
FT                   335294..335299)
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="CAP2UW1_0273"
FT   misc_feature    335285..335563
FT                   /note="Biotin and Thiamin Synthesis associated domain;
FT                   Region: BATS; cl06149"
FT                   /db_xref="CDD:157061"
FT                   /locus_tag="CAP2UW1_0273"
FT   gene            335576..336463
FT                   /db_xref="GeneID:8402402"
FT                   /locus_tag="CAP2UW1_0274"
FT   CDS_pept        335576..336463
FT                   /locus_tag="CAP2UW1_0274"
FT                   /gene_family="HOG000265010" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   dar:Daro_0619 biotin synthesis protein"
FT                   /db_xref="GI:257091919"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:8402402"
FT                   /translation="MNAPAQFVDRRQVRRNFARAAASYDEAAVLQREIGKRMLERLDYV
FT                   RIEPQRVLDLGCGTGASLTALHERYPGALVIGADPCLPMLRVGQRQHSRLRWLLPFLRS
FT                   HRSPLLAAEASALPLPAQSIGLLWSNLMLHWLDDPLPAFREANRLLEVGGLLMFSTFGP
FT                   DTLKELRASFGDGYVHTQRFTDMHDYGDMLVECGFTDPVMDAEVLTMTYARLDDLLADL
FT                   RRSGSACAMQARRRGLTGRSTWAATRAAYAQCAREGRLPATYEVIYGHAWKSQPRKMAD
FT                   GRTIVRFDPHQRLR"
FT                   /protein_id="YP_003165560.1"
FT   misc_feature    335621..336394
FT                   /note="biotin biosynthesis protein BioC; Region: BioC;
FT                   TIGR02072"
FT                   /db_xref="CDD:162684"
FT                   /locus_tag="CAP2UW1_0274"
FT   misc_feature    335726..336058
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="CAP2UW1_0274"
FT   misc_feature    order(335738..335758,335810..335815,335891..335899,
FT                   335963..335965)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="CAP2UW1_0274"
FT   gene            complement(336483..336791)
FT                   /db_xref="GeneID:8402403"
FT                   /locus_tag="CAP2UW1_0275"
FT   CDS_pept        complement(336483..336791)
FT                   /locus_tag="CAP2UW1_0275"
FT                   /gene_family="HOG000126293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   dar:Daro_1619 acetolactate synthase 1 regulatory subunit"
FT                   /db_xref="GI:257091920"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="GeneID:8402403"
FT                   /translation="MNSLTRTENQALARTVLELDVNNHAGVMSHVVGLFSRRAYNVEGI
FT                   LVMPVGSGATSRIWLLVNEDERLDQMVKQVEKLEDVLAVRRHGAEHEVFVRLEEFFV"
FT                   /protein_id="YP_003165561.1"
FT   misc_feature    complement(336537..336746)
FT                   /note="N-terminal ACT domain of the Escherichia coli
FT                   IlvH-like regulatory subunit of acetohydroxyacid synthase
FT                   (AHAS); Region: ACT_AHAS; cd04878"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="CAP2UW1_0275"
FT   misc_feature    complement(order(336624..336626,336651..336653,
FT                   336666..336671,336708..336710,336723..336725,
FT                   336729..336731))
FT                   /note="putative valine binding site; other site"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="CAP2UW1_0275"
FT   misc_feature    complement(order(336621..336623,336651..336665,
FT                   336675..336677,336684..336686,336705..336707,
FT                   336714..336719))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:153150"
FT                   /locus_tag="CAP2UW1_0275"
FT   gene            complement(336795..338474)
FT                   /db_xref="GeneID:8402404"
FT                   /locus_tag="CAP2UW1_0276"
FT   CDS_pept        complement(336795..338474)
FT                   /locus_tag="CAP2UW1_0276"
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: dar:Daro_1620 acetolactate synthase
FT                   catalytic subunit"
FT                   /db_xref="GI:257091921"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="GeneID:8402404"
FT                   /translation="MPKQTPETLTGAQIVVRLLERQGVRTVAGIPGGAILPIYDALSKS
FT                   EIHHVLARHEQGGGFMAQGMARATGVPAVCMASSGPGATNLLTAIADAKLDSIPLVAIT
FT                   GQVPKPMIGTDAFQEVDTYGLSIPITKHNFLVGSADDLLTVIPRAFRIAASGRPGPVLV
FT                   DIPKDVQNQLVDVDEWPAPGCADVVPPPDGELIERAAAMINAAAKPVLYLGGGVVHSGA
FT                   AEAAVALAQKARLPTVMTLMALGAMPVDHVLSLGMLGMHGARCTNLALDECDLLIAVGA
FT                   RFDDRATGKVAGFCPQAKIIHIDIDPSELDKIKTAHVGIAGDVRTVLELLQPVIESPQR
FT                   HAWLARVASLKADHPLRMPGIDDPRTPYGLIRAVANCLDDEATITTDVGQHQMWVAQAY
FT                   PLRRPRQWLTSGGLGTMGFGMPAAIGASLAEPERTVVCFTGDGSILMNIQELVTAAEED
FT                   VNVKIVLMNNSSLGLVFQQQTMFYGERIYASKFKGMPDFIRVAEGFGVPAVDLDKASDP
FT                   LAALAAALATRGPMLIHASIAMHEQVLPMVPPGAANKEMIGG"
FT                   /protein_id="YP_003165562.1"
FT   misc_feature    complement(336798..338468)
FT                   /note="acetolactate synthase catalytic subunit; Validated;
FT                   Region: PRK08155"
FT                   /db_xref="CDD:181257"
FT                   /locus_tag="CAP2UW1_0276"
FT   misc_feature    complement(337974..338438)
FT                   /note="Pyrimidine (PYR) binding domain of POX and related
FT                   proteins; Region: TPP_PYR_POX_like; cd07035"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="CAP2UW1_0276"
FT   misc_feature    complement(order(338187..338192,338199..338201,
FT                   338211..338213,338232..338234,338268..338276,
FT                   338280..338285,338292..338297,338304..338306,
FT                   338313..338333,338355..338357,338367..338369,
FT                   338379..338384,338397..338399))
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="CAP2UW1_0276"
FT   misc_feature    complement(order(338091..338093,338100..338102,
FT                   338202..338204,338211..338216,338220..338225,
FT                   338232..338234,338307..338309,338313..338324,
FT                   338328..338330,338355..338357,338367..338369,
FT                   338376..338384))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="CAP2UW1_0276"
FT   misc_feature    complement(order(338220..338222,338232..338234,
FT                   338310..338312,338382..338384))
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="CAP2UW1_0276"
FT   misc_feature    complement(337482..337889)
FT                   /note="Thiamine pyrophosphate enzyme, central domain;
FT                   Region: TPP_enzyme_M; pfam00205"
FT                   /db_xref="CDD:143962"
FT                   /locus_tag="CAP2UW1_0276"
FT   misc_feature    complement(336825..337379)
FT                   /note="Thiamine pyrophosphate (TPP) family,
FT                   Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding
FT                   module; composed of proteins similar to the large catalytic
FT                   subunit of AHAS. AHAS catalyzes the condensation of two
FT                   molecules of pyruvate to give the...; Region: TPP_AHAS;
FT                   cd02015"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="CAP2UW1_0276"
FT   misc_feature    complement(order(337071..337073,337137..337139,
FT                   337146..337154,337227..337229,337233..337235,
FT                   337302..337313))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="CAP2UW1_0276"
FT   misc_feature    complement(order(336966..336968,336975..336977,
FT                   336987..336992,337107..337109,337128..337133,
FT                   337137..337142,337227..337229,337233..337235,
FT                   337242..337244))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48178"
FT                   /locus_tag="CAP2UW1_0276"
FT   gene            complement(338889..339608)
FT                   /db_xref="GeneID:8402405"
FT                   /locus_tag="CAP2UW1_0277"
FT   CDS_pept        complement(338889..339608)
FT                   /locus_tag="CAP2UW1_0277"
FT                   /gene_family="HOG000125738" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1555"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1555; KEGG:
FT                   dar:Daro_1460 hypothetical protein"
FT                   /db_xref="GI:257091922"
FT                   /db_xref="InterPro:IPR011449"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="GeneID:8402405"
FT                   /translation="MKALRGVLAGMLLAIGGAAHAVPYHFVDWTAANPGAGTASGTITL
FT                   PDLSTVTVSFSVTQVTGAAGSFKFAQTFGGTNYWSPSAPYISSQVDNAPPDSDIISLIG
FT                   GSSTTTYKLTLSEAIKDPIMDIVSLGQPGFNVTYDFDRPFDIVSQGVGFWGGGPTALQE
FT                   LPGDVLQGAEGHGTIQFIGTFDSFSWTAPTSEDWHGFQFGIRTTEKLDPSVPEPASLAL
FT                   LAIGFAGLAAARRRRTR"
FT                   /protein_id="YP_003165563.1"
FT   sig_peptide     complement(339543..339608)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT                   /locus_tag="CAP2UW1_0277"
FT   gene            340095..340598
FT                   /db_xref="GeneID:8402406"
FT                   /locus_tag="CAP2UW1_0278"
FT   CDS_pept        340095..340598
FT                   /locus_tag="CAP2UW1_0278"
FT                   /gene_family="HOG000022345" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Redoxin domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   dar:Daro_0532 thiol peroxidase (atypical 2-Cys
FT                   peroxiredoxin)"
FT                   /db_xref="GI:257091923"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="GeneID:8402406"
FT                   /translation="MASTVTLGGKPFQVGGILPEKGQTAPAFTLVGKDLANVSLSSFAG
FT                   QRKVLNIFPSIDTPTCATSVRKFNEKASGLSNTVVLCVSADLPFAQARFCGAEGLERVV
FT                   TLSTMRGREFLEAYGVALSDGPLAGLAARAVVVLDGDDKVLHSELVAEIKNEPDYDAAL
FT                   KSLA"
FT                   /protein_id="YP_003165564.1"
FT   misc_feature    340152..340589
FT                   /note="Peroxiredoxin (PRX) family, Atypical 2-cys PRX
FT                   subfamily; composed of PRXs containing peroxidatic and
FT                   resolving cysteines, similar to the homodimeric thiol
FT                   specific antioxidant (TSA) protein also known as
FT                   TRX-dependent thiol peroxidase (Tpx). Tpx is a...; Region:
FT                   PRX_Atyp2cys; cd03014"
FT                   /db_xref="CDD:48563"
FT                   /locus_tag="CAP2UW1_0278"
FT   misc_feature    order(340257..340259,340263..340265,340350..340355,
FT                   340371..340373,340419..340421,340476..340481)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48563"
FT                   /locus_tag="CAP2UW1_0278"
FT   misc_feature    order(340266..340268,340275..340277,340491..340493)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:48563"
FT                   /locus_tag="CAP2UW1_0278"
FT   misc_feature    order(340275..340277,340377..340379)
FT                   /note="peroxidatic and resolving cysteines; other site"
FT                   /db_xref="CDD:48563"
FT                   /locus_tag="CAP2UW1_0278"
FT   gene            340651..341529
FT                   /db_xref="GeneID:8402407"
FT                   /locus_tag="CAP2UW1_0279"
FT   CDS_pept        340651..341529
FT                   /locus_tag="CAP2UW1_0279"
FT                   /gene_family="HOG000265245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: dar:Daro_0804 regulatory proteins,
FT                   IclR"
FT                   /db_xref="GI:257091924"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:8402407"
FT                   /translation="MSDTSSTPPVKQRQGIQSIEVGTRLLRALAAHGRAMMLRDVARHA
FT                   GMPPAKAHRYLVSFMRMGLVEQDANTGRYDLGEFALELGLASLARLDPVRLAGPVLDDL
FT                   CEHIGETVALAMWGNHGATCVRWVEAGGPVTVTLRTGVVMPLTSSATGLAFAAFYRSPY
FT                   LRKMLDAEVQATAELRHAAPAAVLSALTVQLDEIRRHGIARASGSVTPGINGFSAPVFG
FT                   HGGRMVAAITCLGIIGNFDLDWDSPMAQATRDAAATLSRRLGYGTVDDGVADRRSAEQA
FT                   GRPGTADGACA"
FT                   /protein_id="YP_003165565.1"
FT   misc_feature    340696..340968
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="CAP2UW1_0279"
FT   misc_feature    340768..341445
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="CAP2UW1_0279"
FT   misc_feature    341047..341436
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="CAP2UW1_0279"
FT   gene            341522..341779
FT                   /db_xref="GeneID:8402408"
FT                   /locus_tag="CAP2UW1_0280"
FT   CDS_pept        341522..341779
FT                   /locus_tag="CAP2UW1_0280"
FT                   /gene_family="HOG000257225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0153"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   bpt:Bpet3113 hypothetical protein"
FT                   /db_xref="GI:257091925"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="GeneID:8402408"
FT                   /translation="MRDCRPDCGACCIAPSITTPMPGHPCGKPAGEPCLSLTADWRCAL
FT                   WGRPERPAFCAGLQPSAEMCGDNRHQAIAWLSALELASRP"
FT                   /protein_id="YP_003165566.1"
FT   gene            341813..342637
FT                   /db_xref="GeneID:8402409"
FT                   /locus_tag="CAP2UW1_0281"
FT   CDS_pept        341813..342637
FT                   /locus_tag="CAP2UW1_0281"
FT                   /gene_family="HOG000218356" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: dar:Daro_3911 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="GI:257091926"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="GeneID:8402409"
FT                   /translation="MDLLLLLKALILGIVEGVTEFLPVSSTGHLILAGDLLNFNDDRGK
FT                   LFEIVIQSGAILAVCWEFRAKIVQVLLGLPSDRAAQRFALNVLVAFLPLAIIGLLFGKA
FT                   IKASLFNAPVVATAFIVGGLVILWAERREHRIRIESIDDLTLLDALKLGLAQALALIPG
FT                   TSRSGATIIGGLFFGLSRRAATEFSFFLAIPTLIGATIYQLYKERALLSFDDLGMWVVG
FT                   FVAAFVSAFWAVRGLLRYISTHDFSAFAWYRIAFGVVVLVTWHYDIVAWTSG"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165567.1"
FT   misc_feature    341849..342607
FT                   /note="Bacitracin resistance protein BacA; Region: BacA;
FT                   cl00858"
FT                   /db_xref="CDD:186224"
FT                   /locus_tag="CAP2UW1_0281"
FT   gene            342639..343211
FT                   /db_xref="GeneID:8402410"
FT                   /locus_tag="CAP2UW1_0282"
FT   CDS_pept        342639..343211
FT                   /locus_tag="CAP2UW1_0282"
FT                   /gene_family="HOG000256044" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0227"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0227; KEGG:
FT                   dar:Daro_3910 hypothetical protein"
FT                   /db_xref="GI:257091927"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="GeneID:8402410"
FT                   /translation="MAGPRILYLHGFCSSPASWKARLLGDHLAAAGLADRFVCPTLPPA
FT                   PFAAIADAEALLAGGDGPTTLVGSSLGGYYAAWLAEKHDLRAVLINPAVMAPVLLGGLV
FT                   GTQTNFHSGEKFEFTTEHVEQLRSLEAASVTPARYLLLVETGDAVLDYRRAVERYAGSR
FT                   QIVIEGGDHSFTHFPELMPQIIEFCGL"
FT                   /protein_id="YP_003165568.1"
FT   misc_feature    342648..343208
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="CAP2UW1_0282"
FT   gene            343220..345136
FT                   /db_xref="GeneID:8402411"
FT                   /locus_tag="CAP2UW1_0283"
FT   CDS_pept        343220..345136
FT                   /locus_tag="CAP2UW1_0283"
FT                   /gene_family="HOG000256055" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease II"
FT                   /transl_table="11"
FT                   /note="PFAM: ribonuclease II; KEGG: dar:Daro_3909
FT                   ribonuclease II"
FT                   /db_xref="GI:257091928"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="GeneID:8402411"
FT                   /translation="MHVLFEEDGAFRTATIVADNDSSLQVETASGKRSKIKSTSVLLRY
FT                   GEPAPAALLEQAEALAGSIEHDFLWECLGDGEFSFSDFANDYFGHVATPVEASALLLAL
FT                   HSAPIYFHRKGKGRFRKAPPDILQAALAGLEKKRQQALSIERMIGELKAFSLPAEFSPL
FT                   LGQLLYKPDRNRGETKALEAACLDTGLSAAHLLARCGAIRSAYDYHLQRFLLEQFPRGT
FT                   DFPDVATPLLPSDLPRADVRAFSIDDAATTEIDDAFSLQTLPGLGWRVGIHIAAPSLGI
FT                   APGSPLDAIARERLSTVYMPGAKITMLPDAAVDRFTLSSGRAAPAVSLYLTVTPDFEVT
FT                   AHESRVEIVPVVANLRHHDIEPLFNEQTIAAGLTDFAFRDELLTLWQLANACEGRRGKP
FT                   SAMQGNHDYNFRIDGDLADAEACRVEISARRRGSPLDKLVAELMIVANSTWGGLLAAQG
FT                   VAAIYRVQTGGKVRMSTAPQAHEGLGVKQYAWSSSPLRRYVDLLNQWQLVACLNGDTPP
FT                   FAARSDALFAAMRDFDLTYSAYADFQRSIERYWSLRWLRQQGLETIEATIVGRENLARL
FT                   DHLPLVQRVPSAPELKPGQRICLRIESIDYLTLELACRYVETLAVAGSPAIAADDEVLE
FT                   AVD"
FT                   /protein_id="YP_003165569.1"
FT   misc_feature    343937..344752
FT                   /note="RNB domain; Region: RNB; pfam00773"
FT                   /db_xref="CDD:144391"
FT                   /locus_tag="CAP2UW1_0283"
FT   gene            345138..346022
FT                   /db_xref="GeneID:8402412"
FT                   /locus_tag="CAP2UW1_0284"
FT   CDS_pept        345138..346022
FT                   /locus_tag="CAP2UW1_0284"
FT                   /gene_family="HOG000219751" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TonB family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: TonB family protein; KEGG: dar:Daro_3908
FT                   TonB, C-terminal"
FT                   /db_xref="GI:257091929"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="GeneID:8402412"
FT                   /translation="MNAGARKGSPHVPDGRRLWLALGVSLLLHVVVLSLHFTFPDAARA
FT                   FQDRALDIILVNSRSARKPSEAQALAQANLDGGGNSEEKRRAKTPLPPAPRHQDGDDLD
FT                   HSQKRIQELEAHQQRLAAQTRSRTTVAPAADKQVQPEPTPSVSGRDLAHSALAMARLEG
FT                   EIAKEVDDYNQRPRKKFIGTRADEYRFAQYNEEWRLKVERVGTLNYPEAARGKLYGSLI
FT                   LTVSIRSDGTVASVEINRSSGHKVLDDAARRIVAMAAPFAAFPPAIRHDTDVLVITRSW
FT                   NFTQRDSLETKAR"
FT                   /protein_id="YP_003165570.1"
FT   misc_feature    <345381..345884
FT                   /note="Periplasmic protein TonB, links inner and outer
FT                   membranes [Cell envelope biogenesis, outer membrane];
FT                   Region: TonB; COG0810"
FT                   /db_xref="CDD:31152"
FT                   /locus_tag="CAP2UW1_0284"
FT   misc_feature    345756..>345884
FT                   /note="Gram-negative bacterial tonB protein; Region: TonB;
FT                   cl10048"
FT                   /db_xref="CDD:175073"
FT                   /locus_tag="CAP2UW1_0284"
FT   gene            346030..346854
FT                   /db_xref="GeneID:8402413"
FT                   /locus_tag="CAP2UW1_0285"
FT   CDS_pept        346030..346854
FT                   /locus_tag="CAP2UW1_0285"
FT                   /gene_family="HOG000237876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: dar:Daro_3907
FT                   shikimate dehydrogenase"
FT                   /db_xref="GI:257091930"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="GeneID:8402413"
FT                   /translation="MSDRYCVFGNPVGHSKSPAIHAAFAAQCRQDLSYEAILAPLDGFA
FT                   ESMRAFAAAGGCGANVTVPFKEQACRLATRLAARAELAGAVNTLVFNGPDILGDNTDGA
FT                   GLLRDLSTNLTCRIAGQRVLLLGAGGAARGVVGPLLDARPAALVIANRTAGRARELAQR
FT                   FAGPAPLLGCAYPEVAGLSFDLVINATSASLTGELPPLPGGVFASGSLAYDMMYGQGPT
FT                   PFLVFAGSHGAACLADGLGMLVEQAAEAFHVWRGVRPETAPVLAMLRAALAR"
FT                   /protein_id="YP_003165571.1"
FT   misc_feature    346030..346848
FT                   /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
FT                   PRK00258"
FT                   /db_xref="CDD:178949"
FT                   /locus_tag="CAP2UW1_0285"
FT   misc_feature    346048..346296
FT                   /note="Shikimate dehydrogenase substrate binding domain;
FT                   Region: Shikimate_dh_N; pfam08501"
FT                   /db_xref="CDD:149523"
FT                   /locus_tag="CAP2UW1_0285"
FT   misc_feature    346330..346797
FT                   /note="NAD(P) binding domain of Shikimate dehydrogenase;
FT                   Region: NAD_bind_Shikimate_DH; cd01065"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="CAP2UW1_0285"
FT   misc_feature    order(346333..346335,346678..346680,346756..346758,
FT                   346765..346767)
FT                   /note="shikimate binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="CAP2UW1_0285"
FT   misc_feature    order(346411..346413,346420..346422,346480..346485,
FT                   346594..346602,346672..346674,346744..346746,
FT                   346753..346758)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:133443"
FT                   /locus_tag="CAP2UW1_0285"
FT   gene            346851..347546
FT                   /db_xref="GeneID:8402414"
FT                   /locus_tag="CAP2UW1_0286"
FT   CDS_pept        346851..347546
FT                   /locus_tag="CAP2UW1_0286"
FT                   /gene_family="HOG000288116" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: dar:Daro_3906 monofunctional biosynthetic
FT                   peptidoglycan transglycosylase"
FT                   /db_xref="GI:257091931"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="GeneID:8402414"
FT                   /translation="MSQLARWLKRLVLGFVALLLLYQLWLFGWVLWWNWVNPDNTRFMS
FT                   IRLDELRVKDPQAQLKKQWAGYDRISANLKHALIAAEDAKFVDHEGFDWEGIQNAIEKN
FT                   QKKGRIVAGGSTISQQLAKNLFLTPAKTPWRKAEEAVITLMLEAVWSKQRIFEVYLNVI
FT                   EWGNGVFGAEAAARHYYGVSAAQLSREQAARLAGMVPSPRFYDRNRNAPGLARKTAIIL
FT                   ARMPSADVP"
FT                   /protein_id="YP_003165572.1"
FT   misc_feature    346944..347543
FT                   /note="Transglycosylase; Region: Transgly; cl07896"
FT                   /db_xref="CDD:186708"
FT                   /locus_tag="CAP2UW1_0286"
FT   gene            347623..348132
FT                   /db_xref="GeneID:8402415"
FT                   /locus_tag="CAP2UW1_0287"
FT   CDS_pept        347623..348132
FT                   /locus_tag="CAP2UW1_0287"
FT                   /gene_family="HOG000225077" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rfr:Rfer_3310 hypothetical protein"
FT                   /db_xref="GI:257091932"
FT                   /db_xref="GeneID:8402415"
FT                   /translation="MKLRTVFLLLILGAIAAFSALNWNHFIAPTTLSLGLTEIQAPLGV
FT                   IMLGVVAFLTAFFLVFVVYVQASALFDSRRHAQELQLNRELADKAEASRFTELRSFLEA
FT                   ELQKLAGVRSGGSPVTADPAILARLDRLEKELLTAVEQSGNSLAACLGEIEDRLERNAA
FT                   APPPRQ"
FT                   /protein_id="YP_003165573.1"
FT   sig_peptide     347623..347682
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.800 at
FT                   residue 20"
FT                   /locus_tag="CAP2UW1_0287"
FT   misc_feature    <347932..>348096
FT                   /note="oxaloacetate decarboxylase; Provisional; Region:
FT                   PRK14040"
FT                   /db_xref="CDD:184472"
FT                   /locus_tag="CAP2UW1_0287"
FT   gene            complement(348180..349604)
FT                   /db_xref="GeneID:8402416"
FT                   /locus_tag="CAP2UW1_0288"
FT   CDS_pept        complement(348180..349604)
FT                   /locus_tag="CAP2UW1_0288"
FT                   /gene_family="HOG000268807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   mms:mma_1202 ATP-dependent RNA helicase"
FT                   /db_xref="GI:257091933"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:8402416"
FT                   /translation="MNFAEIGLHPAILKALTDSGYSEPTPVQQQAIPPAIEGRDLMVSS
FT                   QTGSGKTAAFMLPALHRFALQERPAAVPRPSERGAARPRGHDRQRFQAAQPRMLVLTPT
FT                   RELALQVTAATEKYGRQLHHVRAVAILGGMPYPKQMELLGRNPEILVATPGRLIDHMSS
FT                   GKIDFSQLQILVLDEADRMLDMGFIEDIERIVAATPGSRQTLLFSATLDGTVGELAQRM
FT                   TRAALRIQVDATSARHDNIEQRMHFVDDLAHKNRLLDHLLRDATIDQALVFTATKRDAD
FT                   TVSDRLNVAGLNAAALHGDMHQGARNRTLAAMRRGQVRILVATDVAARGIDVPTITHVF
FT                   NYDLPKFAEDYVHRIGRTGRAGRNGLAISLVHHAEHFNVRKIERFTKQPIPVEIVIGHE
FT                   PTRRPIAVKPRPAGKPAWKGSDNRGLGQPAGRTDNRFSKPSAPKRDGAGRAPYHEAAKG
FT                   SHGGVASGSRRTYGDR"
FT                   /protein_id="YP_003165574.1"
FT   misc_feature    complement(348351..349604)
FT                   /note="ATP-dependent RNA helicase SrmB; Provisional;
FT                   Region: PRK11192"
FT                   /db_xref="CDD:183029"
FT                   /locus_tag="CAP2UW1_0288"
FT   misc_feature    complement(348918..349598)
FT                   /note="DEAD-box helicases. A diverse family of proteins
FT                   involved in ATP-dependent RNA unwinding, needed in a
FT                   variety of cellular processes including splicing, ribosome
FT                   biogenesis and RNA degradation. The name derives from the
FT                   sequence of the Walker  B motif (...; Region: DEADc;
FT                   cd00268"
FT                   /db_xref="CDD:28928"
FT                   /locus_tag="CAP2UW1_0288"
FT   misc_feature    complement(349449..349463)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28928"
FT                   /locus_tag="CAP2UW1_0288"
FT   misc_feature    complement(349065..349076)
FT                   /note="Mg++ binding site; other site"
FT                   /db_xref="CDD:28928"
FT                   /locus_tag="CAP2UW1_0288"
FT   misc_feature    complement(348975..348983)
FT                   /note="motif III; other site"
FT                   /db_xref="CDD:28928"
FT                   /locus_tag="CAP2UW1_0288"
FT   misc_feature    complement(348495..348887)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="CAP2UW1_0288"
FT   misc_feature    complement(order(348627..348635,348708..348713,
FT                   348771..348782))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="CAP2UW1_0288"
FT   misc_feature    complement(order(348525..348527,348534..348536,
FT                   348546..348548,348609..348611))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="CAP2UW1_0288"
FT   gene            complement(349863..350456)
FT                   /db_xref="GeneID:8402417"
FT                   /locus_tag="CAP2UW1_0289"
FT   CDS_pept        complement(349863..350456)
FT                   /locus_tag="CAP2UW1_0289"
FT                   /gene_family="HOG000137785" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Chorismate lyase"
FT                   /transl_table="11"
FT                   /note="PFAM: Chorismate lyase; KEGG: eba:ebA2295
FT                   chorismate:pyruvate lyase, 4-hydroxybenzoate synthetase"
FT                   /db_xref="GI:257091934"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="GeneID:8402417"
FT                   /translation="MNIARRQVWRPSLPRTADSTPLLGWLRDRGSLTARIRSRGRFAVR
FT                   VLRQGLGIPTADEARLLGLDPGVHAWVREVALSCNEQIVVFAHTVLPRRPRGPLTVWLS
FT                   RLGERSLGALLFAHAGFTRGPMAFHRLDRRHALFTAAWAALQLAEQSPATLWARRSRFG
FT                   LGGQSVLVSEVFSPRLAQLPEPGKESWTNGKPVL"
FT                   /protein_id="YP_003165575.1"
FT   misc_feature    complement(349920..350441)
FT                   /note="Chorismate lyase; Region: Chor_lyase; cl01230"
FT                   /db_xref="CDD:186394"
FT                   /locus_tag="CAP2UW1_0289"
FT   gene            complement(350484..350924)
FT                   /db_xref="GeneID:8402418"
FT                   /locus_tag="CAP2UW1_0290"
FT   CDS_pept        complement(350484..350924)
FT                   /locus_tag="CAP2UW1_0290"
FT                   /gene_family="HOG000263735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF192"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   dar:Daro_3253 protein of unknown function DUF192"
FT                   /db_xref="GI:257091935"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="GeneID:8402418"
FT                   /translation="MYRSALSTFLVLLFALPVLADELPRVDLTAGFYRIQAEVAARDPD
FT                   RMQGLMHRRSMPANHGMLFVFAQAARHCMWMRNTLLPLSVAFLDEEGRILNIEDMQPQT
FT                   EDNHCAAKAARYALEMNLGWFAGKGIKPGTRIGGIEQSPRPQ"
FT                   /protein_id="YP_003165576.1"
FT   sig_peptide     complement(350862..350924)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT                   /locus_tag="CAP2UW1_0290"
FT   misc_feature    complement(350517..350825)
FT                   /note="Uncharacterized ACR, COG1430; Region: DUF192;
FT                   cl00627"
FT                   /db_xref="CDD:186112"
FT                   /locus_tag="CAP2UW1_0290"
FT   gene            complement(351017..351343)
FT                   /db_xref="GeneID:8402419"
FT                   /locus_tag="CAP2UW1_0291"
FT   CDS_pept        complement(351017..351343)
FT                   /locus_tag="CAP2UW1_0291"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: spu:576916 hypothetical LOC576916"
FT                   /db_xref="GI:257091936"
FT                   /db_xref="GeneID:8402419"
FT                   /translation="MQETDSRVVLCLTAAALSLCCAGSLAVPKAAEHEDAPVSYGEAAA
FT                   PPKPTNKAAAKTAAPTGRQAVERPQAGKSAGAAAPKASKRPTLGKVAAPKKPPEQAARS
FT                   TRKK"
FT                   /protein_id="YP_003165577.1"
FT   sig_peptide     complement(351263..351343)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.986 at
FT                   residue 27"
FT                   /locus_tag="CAP2UW1_0291"
FT   gene            complement(351408..352997)
FT                   /db_xref="GeneID:8402420"
FT                   /locus_tag="CAP2UW1_0292"
FT   CDS_pept        complement(351408..352997)
FT                   /locus_tag="CAP2UW1_0292"
FT                   /gene_family="HOG000143251" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome d1 heme region"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome d1 heme region; KEGG: dar:Daro_3260
FT                   cytochrome d1, heme region"
FT                   /db_xref="GI:257091937"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:8402420"
FT                   /translation="MTRRQSLAAIALVAALAGTPALVAAAGVQALYREHCSACHGESRL
FT                   GGIGPALLPENLERLRKADAVKVIREGRVATQMPAFGDKLNADEAQQLAEWIYSKVSPA
FT                   PVWGEAEIRNSQVVDAQAAAQPARPGLGLKGADPLNLFIVVETGDHHVSILDGDRLERV
FT                   HRFPSRYALHGGPKFSPDGRFVYFASRDGWITKYDLYNLVVVAEIRAGLNTRNAAVSGD
FT                   GKWVMVGNYLPHSLVLLDAKDLSLVKVIPTLDAAGARTSRVSAVYDAAPRQSFIAALKD
FT                   VPEVWEISYDPDAEAVAEGLVHDYQYKEGHFKPGMFTPRRTLLQDHLDDFFFTQSYLEI
FT                   LGSSRSTPKGQVIFLDGRKKIADLDLPGMPHLGSGITWKWTDPAGRERTVMASPNLNEG
FT                   LVTVIDLGSYQNVRQIRTLGPGFFMRSHENSRYAFTDSMMSPQHKNTLQVIDKQSLEVV
FT                   AEIKAQAGQTLAHVEFTRDGRYALASLWEMDGALLVIDAQTLKEVKRIPASKPVGKYNV
FT                   WNKISRSEGTSH"
FT                   /protein_id="YP_003165578.1"
FT   sig_peptide     complement(352920..352997)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.457 at
FT                   residue 26"
FT                   /locus_tag="CAP2UW1_0292"
FT   misc_feature    complement(352707..352913)
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="CAP2UW1_0292"
FT   misc_feature    complement(351438..352595)
FT                   /note="Cytochrome D1 heme domain; Region: Cytochrom_D1;
FT                   pfam02239"
FT                   /db_xref="CDD:111163"
FT                   /locus_tag="CAP2UW1_0292"
FT   misc_feature    complement(352155..>352589)
FT                   /note="WD40 domain, found in a number of eukaryotic
FT                   proteins that cover a wide variety of functions including
FT                   adaptor/regulatory modules in signal transduction, pre-mRNA
FT                   processing and cytoskeleton assembly; typically contains a
FT                   GH dipeptide 11-24 residues...; Region: WD40; cl02567"
FT                   /db_xref="CDD:154987"
FT                   /locus_tag="CAP2UW1_0292"
FT   misc_feature    complement(order(352155..352157,352167..352169,
FT                   352221..352226,352278..352283,352299..352301,
FT                   352317..352319,352365..352370,352404..352409,
FT                   352425..352427,352437..352439,352479..352481,
FT                   352494..352496,352530..352535,352551..352553,
FT                   352566..352568))
FT                   /note="structural tetrad; other site"
FT                   /db_xref="CDD:29257"
FT                   /locus_tag="CAP2UW1_0292"
FT   gene            complement(352994..354190)
FT                   /db_xref="GeneID:8402421"
FT                   /locus_tag="CAP2UW1_0293"
FT   CDS_pept        complement(352994..354190)
FT                   /locus_tag="CAP2UW1_0293"
FT                   /gene_family="HOG000228576" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Radical SAM domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   dar:Daro_3261 radical SAM"
FT                   /db_xref="GI:257091938"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="GeneID:8402421"
FT                   /translation="MFRISQYMQELSAPRQPGPKLNPPAPVVIWNLIRRCNLTCKHCYS
FT                   ISADTDFPGELATDEIFVVMDDLKGFRVPVLILSGGEPLLRPDIFDIARRAKSMGFYVG
FT                   LSSNGTLIDAANIARIADCDFDYVGVSLDGIGETHDRFRQMPGAFDASLKGIRLCRDLG
FT                   LKIGVRFTMTQDNAQDLPRLLELVEDEGIDRFYFSHLNYAGRGNRNRQDDAQHRLTRWA
FT                   MDLLFDTCRDYQERGLHKEFTSGNNDADGVYFLHWVQKNFPDNAANIRARLVQWGGNSS
FT                   GVNVANIDNLGNVHPDTMWWHYSLGNVRQRPFSAIWTDVSDPLMAGLKQFPRSVSGRCG
FT                   ECRHFDICNGNTRVRAQQLTGDAWAEDPGCYLDDEEIGVAPGRERVPLTPYIKIRRAS"
FT                   /protein_id="YP_003165579.1"
FT   misc_feature    complement(353060..354151)
FT                   /note="Predicted Fe-S oxidoreductases [General function
FT                   prediction only]; Region: COG0535"
FT                   /db_xref="CDD:30881"
FT                   /locus_tag="CAP2UW1_0293"
FT   misc_feature    complement(353561..354103)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="CAP2UW1_0293"
FT   misc_feature    complement(order(353591..353596,353678..353680,
FT                   353798..353800,353867..353875,353945..353950,
FT                   353954..353956,354059..354067,354071..354073,
FT                   354077..354079,354083..354085))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="CAP2UW1_0293"
FT   gene            354475..355299
FT                   /db_xref="GeneID:8402422"
FT                   /locus_tag="CAP2UW1_0294"
FT   CDS_pept        354475..355299
FT                   /locus_tag="CAP2UW1_0294"
FT                   /gene_family="HOG000110051" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /transl_table="11"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   rso:RSc2662 probable transmembrane protein"
FT                   /db_xref="GI:257091939"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="GeneID:8402422"
FT                   /translation="MNAQDISRWQDLAVQYASDFGIKVLAAIAFWVIGRWLIHRVGSLV
FT                   QSALERQKVDATIMRYLGTVINVTLNIVLVIGILGYFGIQTTSFAALFAAAGVAIGLAW
FT                   SGLLSNFAGGVFLIILRPIKVGDFVTVGGITGTVKEVGLFVSAINTPDNVLTLVGNNKI
FT                   FSDTIQNFSTNAYRRVDLKAQLSGAADHAAAMALLKEKIATIPNVLADPAVDVEILEFN
FT                   LVGPVLAVRPYCHTDHYWQVYFDTNRTIRESLAAAGFPAPMPAQAVFVSQQP"
FT                   /protein_id="YP_003165580.1"
FT   misc_feature    354490..355278
FT                   /note="mechanosensitive channel MscS; Provisional; Region:
FT                   PRK10334"
FT                   /db_xref="CDD:182386"
FT                   /locus_tag="CAP2UW1_0294"
FT   misc_feature    354715..355260
FT                   /note="Mechanosensitive ion channel; Region: MS_channel;
FT                   pfam00924"
FT                   /db_xref="CDD:144501"
FT                   /locus_tag="CAP2UW1_0294"
FT   gene            355352..356512
FT                   /db_xref="GeneID:8402423"
FT                   /locus_tag="CAP2UW1_0295"
FT   CDS_pept        355352..356512
FT                   /locus_tag="CAP2UW1_0295"
FT                   /gene_family="HOG000264394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /transl_table="11"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   dar:Daro_3768 phospholipase D/transphosphatidylase"
FT                   /db_xref="GI:257091940"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:8402423"
FT                   /translation="MAARFLPGNRLTLLNSGAEYFPALIRAIDEATHEVHLESYIFEDD
FT                   VTGREVADAMARAARRGVTVRVLVDGFGAREFADRLQPRLVAAGVQAMVYRPDIARFQL
FT                   RRHRLRRLHRKLVVIDGDIAFVGGINVIDDLNTPHQVPPRYDYAVRVEGPLLTPIQEAM
FT                   HRLWELVLWAKLTRRYRLTRAPRKEPPARGEQTAAFLVRDNIRHRRDIEEAYLEAIATA
FT                   QEDILLANAYFLPGRRFRKALHDAVRRKVRVVILLQGRVEYRLLHYATQALYSKLLTAG
FT                   IRIFEYRRSFLHAKVAVIDRHWATVGSSNIDPFSLLLAREANIVVRDGNFADELRNSLQ
FT                   GAMQSGAHELHAESWKRLRWPSRLLRWASYNLVRVLVGIAGYGRKP"
FT                   /protein_id="YP_003165581.1"
FT   misc_feature    355361..355882
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="CAP2UW1_0295"
FT   misc_feature    order(355688..355690,355694..355696,355733..355735,
FT                   355739..355741,355781..355783)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="CAP2UW1_0295"
FT   misc_feature    order(355688..355690,355694..355696,355709..355711,
FT                   355730..355735,355739..355741)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="CAP2UW1_0295"
FT   misc_feature    355970..356395
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="CAP2UW1_0295"
FT   misc_feature    order(356228..356230,356234..356236,356273..356275,
FT                   356279..356281,356312..356314)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="CAP2UW1_0295"
FT   misc_feature    order(356228..356230,356234..356236,356249..356251,
FT                   356270..356275,356279..356281)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="CAP2UW1_0295"
FT   gene            complement(356494..357453)
FT                   /db_xref="GeneID:8402424"
FT                   /locus_tag="CAP2UW1_0296"
FT   CDS_pept        complement(356494..357453)
FT                   /locus_tag="CAP2UW1_0296"
FT                   /gene_family="HOG000252723" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: glutamyl-tRNA synthetase class Ic; KEGG:
FT                   dar:Daro_3769 glutamyl-Q tRNA(Asp) synthetase"
FT                   /db_xref="GI:257091941"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="GeneID:8402424"
FT                   /translation="MSLSRPIADPALGRYRGRFAPSPTGPLHFGSLVAAVGSYLDARAS
FT                   GGDWLLRIEDVDQPRTLPGAADAILRTLEGFGFEWDGEVLVQSRRLDLYRAALVDRQVS
FT                   GDVYACACSRREIAANSPPAAVDGGLVYPGICRNGLAVGRTPRAWRMRVADCEIAFDDR
FT                   VQGHVGQNLERAIGDFVLLRADGQFAYQLAVVVDDAAQGVTEIVRGVDLLESTPRQIWL
FT                   QQRLGLPTPRYAHLPIVTNAAGEKLSKQTRAAAVDPAAGSAPLAAALGFLGHAVPQDLG
FT                   RAPLADFWRWAIAAWSIERVPRGRREYRAAPATQGLRP"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165582.1"
FT   misc_feature    complement(<357163..357408)
FT                   /note="nucleotidyl transferase superfamily; Region:
FT                   nt_trans; cl00015"
FT                   /db_xref="CDD:185776"
FT                   /locus_tag="CAP2UW1_0296"
FT   misc_feature    complement(357361..357372)
FT                   /note="HIGH motif; other site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="CAP2UW1_0296"
FT   misc_feature    complement(357361..357372)
FT                   /note="active site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="CAP2UW1_0296"
FT   misc_feature    complement(order(357361..357363,357370..357372))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="CAP2UW1_0296"
FT   misc_feature    complement(<356707..>356901)
FT                   /note="nucleotidyl transferase superfamily; Region:
FT                   nt_trans; cl00015"
FT                   /db_xref="CDD:185776"
FT                   /locus_tag="CAP2UW1_0296"
FT   misc_feature    complement(356707..356712)
FT                   /note="KMSKS motif; other site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="CAP2UW1_0296"
FT   gene            357574..358461
FT                   /db_xref="GeneID:8402425"
FT                   /locus_tag="CAP2UW1_0297"
FT   CDS_pept        357574..358461
FT                   /locus_tag="CAP2UW1_0297"
FT                   /gene_family="HOG000233259" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: dar:Daro_0629 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="GI:257091942"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="GeneID:8402425"
FT                   /translation="MTDRWITPADAAAILAEAMPYIKRFHGKTIVVKYGGNAMTDDSLK
FT                   QCFARDVVLLKLVGMNVVVVHGGGPQIESLLSRVGKKGQFIQGMRVTDDETMEIVEMVL
FT                   GGQVNKDVVNLINQAGGKAVGLTGKDGSFIRARKLMLANQDNSEDLIDVGQVGDITQID
FT                   PSLIGHLESGGFIPVVAPIGVGKGGETYNINADVVAGKIAEILKAEKLVLLTNTPGVLD
FT                   EAGNLITGMTPKQIDDMVANGTLSGGMLPKIGAALDAARNGVKSVHIIDGRVEHALLLE
FT                   ILTDHGVGTMIKSH"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165583.1"
FT   misc_feature    357613..358449
FT                   /note="AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic
FT                   (NAGK-C) catalyzes the phosphorylation of the gamma-COOH
FT                   group of N-acetyl-L-glutamate (NAG) by ATP in the second
FT                   step of arginine biosynthesis found in some bacteria and
FT                   photosynthetic organisms using...; Region: AAK_NAGK-C;
FT                   cd04250"
FT                   /db_xref="CDD:58616"
FT                   /locus_tag="CAP2UW1_0297"
FT   misc_feature    357613..357642
FT                   /note="feedback inhibition sensing region; other site"
FT                   /db_xref="CDD:58616"
FT                   /locus_tag="CAP2UW1_0297"
FT   misc_feature    order(357616..357624,357628..357630,357637..357642,
FT                   357721..357723,357733..357735,357745..357747,
FT                   357805..357810,357865..357867,357874..357879,
FT                   357892..357894,357901..357903,357913..357915,
FT                   357934..357936,357940..357948,357952..357954,
FT                   357958..357969,358069..358071,358096..358098,
FT                   358399..358401,358408..358413,358423..358425)
FT                   /note="homohexameric interface; other site"
FT                   /db_xref="CDD:58616"
FT                   /locus_tag="CAP2UW1_0297"
FT   misc_feature    order(357670..357672,357679..357684,358153..358155,
FT                   358216..358224,358234..358236,358303..358305,
FT                   358309..358311,358315..358320,358327..358329)
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:58616"
FT                   /locus_tag="CAP2UW1_0297"
FT   misc_feature    order(357772..357777,357838..357843,358147..358149,
FT                   358153..358158)
FT                   /note="N-acetyl-L-glutamate binding site; other site"
FT                   /db_xref="CDD:58616"
FT                   /locus_tag="CAP2UW1_0297"
FT   gene            358565..359131
FT                   /db_xref="GeneID:8402426"
FT                   /locus_tag="CAP2UW1_0298"
FT   CDS_pept        358565..359131
FT                   /locus_tag="CAP2UW1_0298"
FT                   /gene_family="HOG000266042" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; pyrimidine 5'-nucleotidase; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: dar:Daro_0628
FT                   HAD-superfamily hydrolase subfamily IA, variant
FT                   3:pyrimidine 5-nucleotidase"
FT                   /db_xref="GI:257091943"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="GeneID:8402426"
FT                   /translation="MVAYIHEHLGVDRDEATRLRQDYWQRYGATLLGLVRHHGTDPQHF
FT                   LWHTHQFPDLKHMLVCERGLKAMLRRLPGRKIVFSNAPLRYSEAVLELLGISNCFDAVY
FT                   SVERLRFQPKPAVGGFRELLRSERLRADRCIMVEDSLSNLTTARRLGMKTVWVSRSTRR
FT                   PLAVDVRVPSLLDLPGHLSRLQTVS"
FT                   /protein_id="YP_003165584.1"
FT   misc_feature    358700..359035
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="CAP2UW1_0298"
FT   misc_feature    358802..358804
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="CAP2UW1_0298"
FT   gene            359151..363134
FT                   /db_xref="GeneID:8402427"
FT                   /locus_tag="CAP2UW1_0299"
FT   CDS_pept        359151..363134
FT                   /locus_tag="CAP2UW1_0299"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /transl_table="11"
FT                   /note="KEGG: pau:PA14_07500 hypothetical protein; TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="GI:257091944"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:8402427"
FT                   /translation="MREPASPEQQLLEYKAILDHSGIAVVCTRSRLVYRCNPRAEELFG
FT                   WPAGTLVGQLDAVFLPDDASCDALRGTVRPQLRVGKIVDLETRLARRDGSTFVAHLIAR
FT                   AIDPAAPRLGTVWIVRDVTQEVLTRDTSARLLREQQLIFENAETGIVILRERIIQRCNR
FT                   RFAELLGYAADELVGQSTRLYYPSEEAWLETGRRAYAAIAETGIYHGDTIFRRRNGESF
FT                   CCHITGSMMNRANPDEGYVWLYEDVSEKRASAAAMDALLREQTLIFEAAPIGIAFVRDR
FT                   IIQRCNPSLERIFGYSPGQLIGQSTRCFFASEEAWREKGERAQLLIDECGSFVGEVQYC
FT                   KSDGLPIWCRVTGSLANPGEPGDGLVWLFEDVTEKRQADRAMEALLREQALIFERAPTG
FT                   IAFLRDRVIQRCNPSFERIFGYAPGQLLGQSTRVCFASEAAWREAGERAYAVADESGKF
FT                   IGELEYCRADGTPIWCQVTGSLLNPANPAEGYVWLFEDVTARRAAEEALVESLWEQQLI
FT                   FDNAMIGISYHRNRMILRCNRRCEEIFGYLEGGLAGQPTRVLFASDEAWEAVGRQVYGE
FT                   SASGETFDGELLYQRRDGTPIWVHAIGRTIGESADSETWIWAYADVTAQRAAEQALRQS
FT                   HLELEQRVADRTLELSQQLHFMRQLIEAIPGPVFYKSQEGRYLGCNQAFLELIGKSRDE
FT                   VVGATVYDVAPADLADRYKAADDELLARLGSQVYEARVLDADGHYRDVIFHKATYGKPG
FT                   ENGGGLVGVMLDITERKRMEARLLQAATVFDSSAEGITITAPDGNIIAVNRAFTEITGY
FT                   TEDEVIGRNPRMLQSGFQDRRFYLDMWQALGTQGRWRGELWNRRKDGQTFLESLTISAV
FT                   KDAQGKVAHYVGVFSDITELRRAHDQLDHQAHHDPLTGLPNRLLLGDRLHKALQRAHRD
FT                   ETGLAVFFIDLDRFKNINDTLGHQVGDRVLCEVAWRLGRLMRESDTVGRLGGDEFLIVI
FT                   EDVGEPTAVSHIAEKILNVLQASPVTVEHEFFVGASIGISVFPQDGADAETLMKNADVA
FT                   MYRAKERGRNTYEFFTKDLTQTSLARLQMETDLRRAIERGELRVYLQPQFSLATGKVVG
FT                   AEALVRWLRPQQGLVLPGEFIKLAEESGLIVPIGEWVQGTAACQWATWVAAGLAPGVLS
FT                   VNVSGVEFARGRIQQTARRTLELSGLPARFLELEITESAIMSHAENSVQVLDNLRAMGI
FT                   SLVIDDFGTGYSSLAYLKRLPLNKLKVDQSFVRGLPNDTEDCAIARAVIALGHSLQLTV
FT                   IAEGVETEAQREFLTGEGCDEMQGYLRGRPMPFDDYHARFLSG"
FT                   /protein_id="YP_003165585.1"
FT   misc_feature    359190..359537
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    359208..359516
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(359256..359258,359268..359270,359286..359288,
FT                   359322..359333,359415..359417,359430..359432)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(359313..359315,359325..359327,359355..359357,
FT                   359364..359369,359451..359453,359457..359459)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    359559..359717
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    359571..359903
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    359946..360293
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    359946..>360065
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    360294..360671
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    360336..360641
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(360381..360383,360393..360395,360411..360413,
FT                   360450..360461,360540..360542,360555..360557)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(360441..360443,360453..360455,360477..360479,
FT                   360489..360494,360576..360578,360582..360584)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    360696..361046
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    361122..361478
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    361140..361448
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(361188..361190,361200..361202,361218..361220,
FT                   361257..361268,361344..361346,361359..361361)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(361248..361250,361260..361262,361284..361286,
FT                   361293..361298,361380..361382,361386..361388)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    361464..361829
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    361506..361814
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(361554..361556,361566..361568,361584..361586,
FT                   361623..361634,361710..361712,361725..361727)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(361614..361616,361626..361628,361650..361652,
FT                   361659..361664,361746..361748,361752..361754)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    361866..362333
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(361968..361970,362097..362099)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(361983..361985,361992..361997,362007..362009,
FT                   362019..362021,362085..362087,362091..362102)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    order(362073..362075,362160..362162)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="CAP2UW1_0299"
FT   misc_feature    362385..363107
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="CAP2UW1_0299"
FT   gene            363127..364221
FT                   /db_xref="GeneID:8402428"
FT                   /locus_tag="CAP2UW1_0300"
FT   CDS_pept        363127..364221
FT                   /locus_tag="CAP2UW1_0300"
FT                   /gene_family="HOG000225220" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyltransferase 3"
FT                   /transl_table="11"
FT                   /note="PFAM: acyltransferase 3; KEGG: rme:Rmet_4573
FT                   acyltransferase 3"
FT                   /db_xref="GI:257091945"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="GeneID:8402428"
FT                   /translation="MAEAPLPGSGPRLAFVDALKAVASQLIVLHHLAFYGPMSDHAHSL
FT                   LPNLVSWLSQEARIAVQAFLVIGGFLAAQSLAPSGVLLAPRPLSLLWRRYLKLVIPYLA
FT                   AVLLGIACAAIARRLMTHDSLPGLPTLPQVVAHAFLLQSILGYEGLSAGVWYIAIDFQL
FT                   FALLLGILWLARRLGQGAGRAAFVGALLVGALALASLYHFNRDADWDVWGVYFFGSYAL
FT                   GVLIYWATARKQPIAGWLLLLVVPVVTALLVDYRSRIAVALVVALALGLARCTGFLDSW
FT                   PRSRLIAGLGKISYSVFLVHFPVCLVVSGLFARFAPPTAGVNLAGMVIAWLASMAAGAL
FT                   FYRLVESRAPVRRRCPAAGFKQKP"
FT                   /protein_id="YP_003165586.1"
FT   misc_feature    363151..>363597
FT                   /note="Predicted acyltransferases [Lipid metabolism];
FT                   Region: COG1835; cl00792"
FT                   /db_xref="CDD:186190"
FT                   /locus_tag="CAP2UW1_0300"
FT   gene            complement(364205..365221)
FT                   /db_xref="GeneID:8402429"
FT                   /locus_tag="CAP2UW1_0301"
FT   CDS_pept        complement(364205..365221)
FT                   /locus_tag="CAP2UW1_0301"
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   eba:ebA1071 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="GI:257091946"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="GeneID:8402429"
FT                   /translation="MDYTGSFPTRRMRRMRRDDFSRRLMRESRLDVDDLIYPVFVLAGV
FT                   GRVEPVASMPGVERQSLDQLLKTAERALALGIPALALFPVVDASGKSSGAEEAYNPDGL
FT                   VPHVVAALKKEFPELGVITDVALDPYTSHGQDGLIDADDPRGYVLNDETLEVLARQALS
FT                   HAQAGADIVAPSDMMDGRVARIRGALDAAGHIHTRILAYSAKYASSFYGPFRDAVGSAG
FT                   NLGKGTKHSYQMDPANSDEALREVALDLAEGADMVMVKPGMPYLDIVRRVKDEFKVPTY
FT                   VYQVSGEYAMLKAAAQNGWLDEQACVLESLLACKRAGADGILSYHALSAAAWLKASA"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165587.1"
FT   misc_feature    complement(364244..365143)
FT                   /note="Porphobilinogen synthase (PBGS), which is also
FT                   called delta-aminolevulinic acid dehydratase (ALAD),
FT                   catalyzes the condensation of two 5-aminolevulinic acid
FT                   (ALA) molecules to form the pyrrole porphobilinogen (PBG),
FT                   which is the second step in the...; Region:
FT                   ALAD_PBGS_aspartate_rich; cd04823"
FT                   /db_xref="CDD:88599"
FT                   /locus_tag="CAP2UW1_0301"
FT   misc_feature    complement(order(364274..364276,364283..364285,
FT                   364295..364297,364304..364306,364349..364351,
FT                   364421..364435,364487..364492,364499..364501,
FT                   364508..364519,364526..364531,364592..364600,
FT                   364685..364690,364769..364774,365057..365059,
FT                   365066..365068,365138..365143))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88599"
FT                   /locus_tag="CAP2UW1_0301"
FT   misc_feature    complement(order(364247..364249,364364..364366,
FT                   364373..364375,364442..364444,364523..364525,
FT                   364535..364537,364562..364564,364577..364582,
FT                   364589..364591,364607..364609,364697..364699,
FT                   364814..364816,364838..364840,364844..364846,
FT                   364850..364852))
FT                   /note="active site"
FT                   /db_xref="CDD:88599"
FT                   /locus_tag="CAP2UW1_0301"
FT   misc_feature    complement(order(364694..364696,364814..364816,
FT                   364838..364840))
FT                   /note="aspartate-rich active site metal binding site; other
FT                   site"
FT                   /db_xref="CDD:88599"
FT                   /locus_tag="CAP2UW1_0301"
FT   misc_feature    complement(order(364475..364477,364487..364489,
FT                   364685..364687))
FT                   /note="allosteric magnesium binding site; other site"
FT                   /db_xref="CDD:88599"
FT                   /locus_tag="CAP2UW1_0301"
FT   misc_feature    complement(order(364442..364444,364607..364609))
FT                   /note="Schiff base residues; other site"
FT                   /db_xref="CDD:88599"
FT                   /locus_tag="CAP2UW1_0301"
FT   gene            complement(365409..366113)
FT                   /db_xref="GeneID:8402430"
FT                   /locus_tag="CAP2UW1_0302"
FT   CDS_pept        complement(365409..366113)
FT                   /locus_tag="CAP2UW1_0302"
FT                   /gene_family="HOG000009832" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /transl_table="11"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   dar:Daro_0625 cell division checkpoint GTPase YihA"
FT                   /db_xref="GI:257091947"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR005289"
FT                   /db_xref="GeneID:8402430"
FT                   /translation="MPLFQQAAFHTTVADLRDLPSDSLCEVAFAGRSNAGKSSAINTLA
FT                   NHSRLAFVSKTPGRTQHLNYFRLADGKYFVDLPGYGFAKAPEEIRSQWEGLLAPYLRHR
FT                   EVLRGLVLIMDSRHPLTELDVQMLRWFAPTGKPLHVLLSKADKLTRQEQVLALREVHAV
FT                   LQEFGENGSVQLFSSLKKSGVREAETVLAGWLGLTMREETPPPAGLSTEKKARPKQRAA
FT                   MGWGARNAGKPR"
FT                   /protein_id="YP_003165588.1"
FT   misc_feature    complement(365529..366038)
FT                   /note="The YihA (EngB) subfamily.  This subfamily of
FT                   GTPases is typified by the E. coli YihA, an essential
FT                   protein involved in cell division control.  YihA and its
FT                   orthologs are small proteins that typically contain less
FT                   than 200 amino acid residues and...; Region: YihA_EngB;
FT                   cd01876"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   misc_feature    complement(366000..366023)
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   misc_feature    complement(order(365580..365585,365676..365678,
FT                   365682..365684,365886..365888,365934..365942,
FT                   365949..365957,365997..366017))
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   misc_feature    complement(365925..365945)
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   misc_feature    complement(365934..365936)
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   misc_feature    complement(365877..365888)
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   misc_feature    complement(order(365793..365798,365805..365849,
FT                   365868..365879))
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   misc_feature    complement(365676..365687)
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   misc_feature    complement(365577..365585)
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133278"
FT                   /locus_tag="CAP2UW1_0302"
FT   gene            366245..366880
FT                   /db_xref="GeneID:8402431"
FT                   /locus_tag="CAP2UW1_0303"
FT   CDS_pept        366245..366880
FT                   /locus_tag="CAP2UW1_0303"
FT                   /gene_family="HOG000221626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c class I"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome c class I; KEGG: dar:Daro_0624
FT                   cytochrome c, class I"
FT                   /db_xref="GI:257091948"
FT                   /db_xref="InterPro:IPR003088"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR008169"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:8402431"
FT                   /translation="MIRTTVLAVLLAASFPAFATEQAKAKPDLAKAKEIAEGVCVACHG
FT                   ADGNSPAPANPILAGQISEYLYKQLSNFKAADGKPAVRNNAIMGGMVAALSDEDMRNLA
FT                   AYFSQQKMKPSLAKEEKLLAEGKTLWRMGDFEKGIPACAGCHGPAGAGLPVQYPRLAGQ
FT                   YAEYTASQLKTFRSHERANDSEKVMRTIAGKLSDHQIAAVAEYAAGLR"
FT                   /protein_id="YP_003165589.1"
FT   sig_peptide     366245..366304
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT                   /locus_tag="CAP2UW1_0303"
FT   misc_feature    366269..366637
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="CAP2UW1_0303"
FT   misc_feature    366323..366574
FT                   /note="putative heme-binding domain,
FT                   Pirellula/Verrucomicrobium type; Region: CxxCH_TIGR02603"
FT                   /db_xref="CDD:131652"
FT                   /locus_tag="CAP2UW1_0303"
FT   misc_feature    <366713..366877
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:187027"
FT                   /locus_tag="CAP2UW1_0303"
FT   gene            367009..367440
FT                   /db_xref="GeneID:8402432"
FT                   /locus_tag="CAP2UW1_0304"
FT   CDS_pept        367009..367440
FT                   /locus_tag="CAP2UW1_0304"
FT                   /gene_family="HOG000187909" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CBS domain containing membrane protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   dar:Daro_0623 CBS"
FT                   /db_xref="GI:257091949"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:8402432"
FT                   /translation="MKTLRQILADKSGPLVIVSPDDAVFHALQVMADHNVGAVLVLDGK
FT                   QLVGIFSERDYARKVILFGKASKDTRVREIMTDKVLYVTPDRTVDECMAIMTEKHFRHL
FT                   PVLDDDGRVVGIVSIGDVVKETICEQQFIIQQMEKYITG"
FT                   /protein_id="YP_003165590.1"
FT   misc_feature    367045..367380
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so-...; Region: CBS_pair_10; cd04623"
FT                   /db_xref="CDD:73122"
FT                   /locus_tag="CAP2UW1_0304"
FT   misc_feature    367051..367377
FT                   /note="FOG: CBS domain [General function prediction only];
FT                   Region: COG0517"
FT                   /db_xref="CDD:30863"
FT                   /locus_tag="CAP2UW1_0304"
FT   gene            complement(367546..368184)
FT                   /db_xref="GeneID:8402433"
FT                   /locus_tag="CAP2UW1_0305"
FT   CDS_pept        complement(367546..368184)
FT                   /locus_tag="CAP2UW1_0305"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Phosphoglycerate mutase"
FT                   /transl_table="11"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: dar:Daro_0602
FT                   phosphoglycerate mutase"
FT                   /db_xref="GI:257091950"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:8402433"
FT                   /translation="MEATRICLVRHGETNWNAQQRIQGQIDIGLNAAGLAQAAAAARWL
FT                   VGQPVVALYSSDLLRARQTAESIATTLKLLPILRPEFRERRYGLFEGLTYAESRAAYAA
FT                   DYLSFERRDPDFVIPCGGESLQQLHERVSTGLRLLAAGHRGETIVVVTHGGVLDIVNRL
FT                   VRGNPLSSPRDFLIPNAAINWVSAHGDAWRLEVWGQTEHLAKFGLDELP"
FT                   /protein_id="YP_003165591.1"
FT   misc_feature    complement(367594..368172)
FT                   /note="Histidine phosphatase domain found in
FT                   phosphoglycerate mutases and related proteins, mostly
FT                   phosphatases; contains a His residue which is
FT                   phosphorylated during the reaction; Region: HP_PGM_like;
FT                   cd07067"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="CAP2UW1_0305"
FT   misc_feature    complement(order(367723..367728,368005..368007,
FT                   368152..368157))
FT                   /note="catalytic core; other site"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="CAP2UW1_0305"
FT   gene            368668..369141
FT                   /db_xref="GeneID:8402434"
FT                   /locus_tag="CAP2UW1_0306"
FT   CDS_pept        368668..369141
FT                   /locus_tag="CAP2UW1_0306"
FT                   /gene_family="HOG000163385" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: azo:azo2931 hypothetical protein"
FT                   /db_xref="GI:257091951"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="GeneID:8402434"
FT                   /translation="MQKSLHIDPGKCTGCLQCEMACSYENTGLFNPATSRIKVFDFHHE
FT                   GRKVPYTCTQCAEAWCLNACPVEAIKIDAGTGAKVVVDAICVGCKVCTIACPFGTINYN
FT                   HGSGKVQKCDLCGGDPACASACPTSAITYIDADWTGLERMRQWAQKTDSAARV"
FT                   /protein_id="YP_003165592.1"
FT   misc_feature    368686..>369078
FT                   /note="Fe-S-cluster-containing hydrogenase components 1
FT                   [Energy production and conversion]; Region: HybA; COG0437"
FT                   /db_xref="CDD:30786"
FT                   /locus_tag="CAP2UW1_0306"
FT   gene            369154..371001
FT                   /db_xref="GeneID:8402435"
FT                   /locus_tag="CAP2UW1_0307"
FT   CDS_pept        369154..371001
FT                   /locus_tag="CAP2UW1_0307"
FT                   /gene_family="HOG000014651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase; KEGG: azo:azo2930 probable
FT                   aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="GI:257091952"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="GeneID:8402435"
FT                   /translation="MAWTRKVLRVNLTQGSCVSEPLNMAWAAQYLGQRGLASKYLVSEI
FT                   DPLVDPLAAENKIIYATGPLTGTMASTGGRYSVVTKGPLTGVIACSNSGGFFGAELKAA
FT                   GWDMIIVEGKSPRPVYLHIENDKAVLLAAEDLWGRTVWDTEGTLKKRHQDPLLRVSSIG
FT                   RAGENQVLFAAIVNDLHRAAGRSGVGAVMGSKNLKAIAVRGTLGVGNIADPKSFMAAVA
FT                   AGKKVLAENAVTGQGLPTYGTQVLMNVINEMGASPTRNHRDVQFEGARKISAEAMHEKR
FT                   TTDGKTHLVTNQACFGCTIACGRISRIDETHFSVETKPQYWGASGGLEYEAAWALGNAN
FT                   GVDDLEALQYANLVCNEDGMDPISFGATVGAVMELYELGILTRDDIGLEAPFGSAEALC
FT                   RLAEMTARGEGFGKVVGLGSKRLCTRYGRPDLSMTVKGQEFPAYDGRALQGMGLAYATS
FT                   NRGACHLRGYMVSSEVFGIPVKTDPRETAGKPELLKAFQDATAAVDSSGLCVFTTFAWT
FT                   MNDIQPQIQSACEGDWSLESLLQTGERIWNLERDFNLAAGITGKDDTLPPRLLNEPCKT
FT                   GASKGMVAELGKMLPEYYSLRGWTPDGVPTAATRARLGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_003165593.1"
FT   misc_feature    369160..370998
FT                   /note="Aldehyde:ferredoxin oxidoreductase [Energy
FT                   production and conversion]; Region: COG2414"
FT                   /db_xref="CDD:32549"
FT                   /locus_tag="CAP2UW1_0307"
FT   misc_feature    369160..369768
FT                   /note="Aldehyde ferredoxin oxidoreductase, N-terminal
FT                   domain; Region: AFOR_N; cl08354"
FT                   /db_xref="CDD:158266"
FT                   /locus_tag="CAP2UW1_0307"
FT   misc_feature    369802..370998
FT                   /note="Aldehyde ferredoxin oxidoreductase, domains 2 & 3;
FT                   Region: AFOR_C; pfam01314"
FT                   /db_xref="CDD:144786"
FT                   /locus_tag="CAP2UW1_0307"
FT   gene            371003..372253
FT                   /db_xref="GeneID:8402436"
FT                   /locus_tag="CAP2UW1_0308"
FT   CDS_pept        371003..372253
FT                   /locus_tag="CAP2UW1_0308"
FT                   /gene_family="HOG000276711" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ajs:Ajs_3945 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="GI:257091953"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:8402436"
FT                   /translation="MASHVIIGNGPAGVVAAETLRRVDPHSEITLIGDEAEPPYSRMAI
FT                   PYLLMGRIGEEGTYLRKDAGHFEGLRIRLRQGRVTALDTGARRLRLADGSGLAYDRLLI
FT                   ATGAHPVRPPIPGIDSPKVLTCWTLADARAIAATVNPGARVLQMGAGFIGCIIMESLAA
FT                   RGPRLTVVEMGDRMVPRMMDEVAGAMIRRWCEDKGVGVRTGRQVVAIAPAGEALRVTLD
FT                   DGEAIEVDVLISATGVKPNIAFLAGSGVAVDAGILVDEAMQTNIAGVHAAGDVAEAVEL
FT                   GTGRRVVNAIQPDAVEQARIAALNMAGQAATLRGTFVFNVLDTLGLISVSFGQWQGVPG
FT                   GETASLVDQADYRYLRLVFDGDRLVGANSIGHTEHIGVLRGLIQGRVRLGPWKDRLLAN
FT                   PLQLSEAYLARGLAALH"
FT                   /protein_id="YP_003165594.1"
FT   misc_feature    371015..>372196
FT                   /note="NAD(P)H-nitrite reductase [Energy production and
FT                   conversion]; Region: NirB; COG1251"
FT                   /db_xref="CDD:31443"
FT                   /locus_tag="CAP2UW1_0308"
FT   misc_feature    371432..371677
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="CAP2UW1_0308"
FT   gene            372253..372507
FT                   /db_xref="GeneID:8402437"
FT                   /locus_tag="CAP2UW1_0309"
FT   CDS_pept        372253..372507
FT                   /locus_tag="CAP2UW1_0309"
FT                   /gene_family="HOG000280991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamineS protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamineS protein; KEGG: lch:Lcho_1819
FT                   thiamineS protein"
FT                   /db_xref="GI:257091954"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="GeneID:8402437"
FT                   /translation="MEIVFKLFASLSDHLPAAARRTNALPLEVADDCSVAALIDSWSLP
FT                   PRMVHLVLVNGEYIPPSQRAGRLLTAGDVVAIWPPIAGG"
FT                   /protein_id="YP_003165595.1"
FT   misc_feature    372292..372504
FT                   /note="Ubiquitin-like proteins; Region: UBQ; cl00155"
FT                   /db_xref="CDD:185802"
FT                   /locus_tag="CAP2UW1_0309"
FT   gene            372526..372789
FT                   /db_xref="GeneID:8402438"
FT                   /locus_tag="CAP2UW1_0310"
FT   CDS_pept        372526..372789
FT                   /locus_tag="CAP2UW1_0310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:257091955"
FT                   /db_xref="GeneID:8402438"
FT                   /translation="MTLTLREFERQLRPLLAGWSVDRLAEGWRLRQEARTVDICCRPLP
FT                   ALPLGALALPRLAVSIDFAGSEPLQEAAFIDDFMHCFRRGGG"
FT                   /protein_id="YP_003165596.1"
FT   gene            372808..372910
FT                   /db_xref="GeneID:8402439"
FT                   /locus_tag="CAP2UW1_R0006"