(data stored in ACNUC30567 zone)

HOGENOMDNA: ACEP3_2

ID   ACEP3_2; SV 1; empty ; DNA; empty ; PRO; 191799 BP.
XX
AC   NC_013210;
XX
PR   Project: 59279;
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-011, complete
DE   sequence.
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
XX
RN   [1]
RP   1-191799
RX   PUBMED; 19638423.
RA   Azuma,Y., Hosoyama,A., Matsutani,M., Furuya,N., Horikawa,H., Harada,T.,
RA   Hirakawa,H., Kuhara,S., Matsushita,K., Fujita,N. and Shirai,M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37 (17), 5768-5783 (2009)
XX
RN   [2]
RP   1-191799
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-SEP-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-191799
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma,Y. and Hosoyama,A.;
RT   "Direct Submission";
RL   Submitted (06-APR-2009) Contact:Yoshinao Azuma Yamaguchi University School
RL   of Medicine, Department of Microbiology and Immunology; Minami-Kogushi
RL   1-1-1, Ube, Yamaguchi 755-8505, Japan URL
RL   :http://www.bio.nite.go.jp/dogan/Top
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to AP011122.
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty of
CC   Agriculture, Kyushu University, Department of Biological Chemistry,
CC   Faculty of Agriculture, Yamaguchi University and Mizkan Group
CC   Corporation Central Research Institute.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..191799
FT                   /mol_type="genomic DNA"
FT                   /db_xref="NBRC:105184"
FT                   /db_xref="taxon:634452"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /strain="IFO 3283"
FT                   /plasmid="pAPA01-011"
FT                   /sub_strain="IFO 3283-01"
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT   gene            complement(287..550)
FT                   /db_xref="GeneID:8426670"
FT                   /locus_tag="APA01_40010"
FT   CDS_pept        complement(287..550)
FT                   /locus_tag="APA01_40010"
FT                   /gene_family="HOG000266653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512910"
FT                   /db_xref="GeneID:8426670"
FT                   /translation="MKSDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT                   /protein_id="YP_003189167.1"
FT   misc_feature    complement(335..538)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="APA01_40010"
FT   gene            639..953
FT                   /db_xref="GeneID:8426493"
FT                   /locus_tag="APA01_40012"
FT   CDS_pept        639..953
FT                   /locus_tag="APA01_40012"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512911"
FT                   /db_xref="GeneID:8426493"
FT                   /translation="MEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQN
FT                   AYIERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA
FT                   "
FT                   /protein_id="YP_003189168.1"
FT   misc_feature    <654..815
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="APA01_40012"
FT   gene            complement(1020..1358)
FT                   /db_xref="GeneID:8426494"
FT                   /locus_tag="APA01_40020"
FT   CDS_pept        complement(1020..1358)
FT                   /locus_tag="APA01_40020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA helicase II UvrD/Rep"
FT                   /transl_table="11"
FT                   /note="Probably pseudogene, Middle domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="GI:258512912"
FT                   /db_xref="GeneID:8426494"
FT                   /translation="MAGHHVEAMIARAHAQKRFMDDAGWRYVVELYGRYQSLLREQNAA
FT                   DFGDLLMWPTLAMLHNDAYRYRWSRRFTAVMADEFQDVNRAQFLWLKMISEVSAEFFAV
FT                   GDDSQSIL"
FT                   /protein_id="YP_003189169.1"
FT   misc_feature    complement(<1026..>1316)
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:175496"
FT                   /locus_tag="APA01_40020"
FT   gene            1437..2498
FT                   /db_xref="GeneID:8426495"
FT                   /locus_tag="APA01_40030"
FT   CDS_pept        1437..2498
FT                   /locus_tag="APA01_40030"
FT                   /gene_family="HOG000255700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="IS116/IS110/IS902"
FT                   /db_xref="GI:258512913"
FT                   /db_xref="GeneID:8426495"
FT                   /translation="MVVGRNDCAKGRQMKDTVIGVDLAKNIFQVHGASRAGEVMFRKKL
FT                   RRQQFMQFMATQPPALVVLEACGSAHYWARELAGAGHEVRLIAPQYVKPFVKRQKNDAA
FT                   DAEAIVIAARQPEMRFVEPRTEAQQARGVLFRARQRLVHQRTELVNALRAVLYEFGLVV
FT                   PQGIAHIRHIEAMLDEAVLPEAVKQECLDLLRQISEQSVRIDVRTKKIRMLAQESENTC
FT                   RLQSMPGVGPLTALAIEAFAPDLQSFRRGRDFAAWLGLVPRQFSSGGKERLGKISKAGQ
FT                   ADIRRLLIMGAMTQVNWASRKAPAPGSWLARMLARKPRMLVAIALANRMARAIWAMATK
FT                   QEDYRDPALSVAA"
FT                   /protein_id="YP_003189170.1"
FT   misc_feature    1485..2450
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3547"
FT                   /db_xref="CDD:33349"
FT                   /locus_tag="APA01_40030"
FT   misc_feature    1665..1940
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="APA01_40030"
FT   misc_feature    2103..2330
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="APA01_40030"
FT   gene            complement(3042..4082)
FT                   /db_xref="GeneID:8426496"
FT                   /locus_tag="APA01_40040"
FT   CDS_pept        complement(3042..4082)
FT                   /locus_tag="APA01_40040"
FT                   /gene_family="HOG000255700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="IS116/IS110/IS902"
FT                   /db_xref="GI:258512914"
FT                   /db_xref="GeneID:8426496"
FT                   /translation="MEQIIRIGMDTSKSVFQLHGVNAKEQPVLRRKLSRREMVKFFEKL
FT                   PPIEIAIEACGASHYWGRVLSCLGHTVKLIAPQLVKPYVKRGKNDAADAEALCEAMSRP
FT                   TMRFVPLKSEEEQAALMLIGMRARLIRNRTQLANTIRGYAAEFGITAPKGMCRIEALLD
FT                   RIAADESLPTLTRELFALHAKEYAELQGEIEQLEGKVMAWHRANECSQRLAKIPGVGPI
FT                   GAALLMMKTPDPHLFKSGRAFAAWIGLTPRDHSTGGKTRLGRITRAGDEVLRSTLVVGA
FT                   TAVVSHARRTNGKNASSWLRELLERKKPKLAAVALANKIARIAWKLMVSGEHYKRLLQQ
FT                   PGAAAV"
FT                   /protein_id="YP_003189171.1"
FT   misc_feature    complement(3099..4070)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3547"
FT                   /db_xref="CDD:33349"
FT                   /locus_tag="APA01_40040"
FT   misc_feature    complement(3618..3890)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="APA01_40040"
FT   misc_feature    complement(3222..3452)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="APA01_40040"
FT   gene            complement(4115..4558)
FT                   /db_xref="GeneID:8426497"
FT                   /locus_tag="APA01_40050"
FT   CDS_pept        complement(4115..4558)
FT                   /locus_tag="APA01_40050"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA resolvase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512915"
FT                   /db_xref="GeneID:8426497"
FT                   /translation="MVPPKPGKTPVGGRLIGYARVSTDDQGTDAQLNELRDAGCTMIFE
FT                   KHASGADRNRPVLIRLLRDMNAGDTLVVVRLDRLARSVSHLLAVIEQLDYAGAHFRSLD
FT                   DPIDTTTPQGMFSLQVLGAVAQLDADFFCDGVDGSQRHRDVPR"
FT                   /protein_id="YP_003189172.1"
FT   misc_feature    complement(4166..4516)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_40050"
FT   misc_feature    complement(order(4316..4318,4325..4330,4493..4495,
FT                   4499..4501))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_40050"
FT   misc_feature    complement(4493..4495)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_40050"
FT   misc_feature    complement(order(4175..4177,4187..4192,4196..4201,
FT                   4331..4333))
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_40050"
FT   misc_feature    complement(order(4169..4171,4178..4180,4187..4192,
FT                   4199..4204,4211..4213,4295..4300,4313..4315))
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_40050"
FT   misc_feature    complement(order(4166..4168,4175..4177,4187..4189,
FT                   4196..4201,4208..4213,4238..4246))
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_40050"
FT   misc_feature    complement(order(4166..4168,4175..4177,4187..4189,
FT                   4196..4198,4244..4246))
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_40050"
FT   gene            4860..5111
FT                   /db_xref="GeneID:8426498"
FT                   /locus_tag="APA01_40060"
FT   CDS_pept        4860..5111
FT                   /locus_tag="APA01_40060"
FT                   /gene_family="HOG000275649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512916"
FT                   /db_xref="GeneID:8426498"
FT                   /translation="MLTSRIHRRKPMGKPMSKATARANAAKSSIRAHVEHVFAHQKNRF
FT                   NLFIRTIGLARAEAKLTLCNLAYNFNRLIFHERLETAG"
FT                   /protein_id="YP_003189173.1"
FT   misc_feature    <4872..5069
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="APA01_40060"
FT   gene            5357..6835
FT                   /db_xref="GeneID:8426499"
FT                   /locus_tag="APA01_40070"
FT   CDS_pept        5357..6835
FT                   /locus_tag="APA01_40070"
FT                   /gene_family="HOG000202982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="D-mannonate oxidoreductase"
FT                   /transl_table="11"
FT                   /note="Mannitol dehydrogenase, NADPH-dependent L-sorbose
FT                   reductase"
FT                   /db_xref="GI:258512917"
FT                   /db_xref="GeneID:8426499"
FT                   /translation="MNLNRNAISHVPDTVYTPRYDPALLRPGIVHLGCGNFHRGHQVVA
FT                   TQAAIDAEGRDGLRWGIVSATMRRPDLATVLQSQDNLYTLLTREPANTVASVMAAITEA
FT                   VYAGDDNANLAARIADPATAIVTLTVTASGYYLSADGRLDPTFEAIQADLTAITPRTAP
FT                   GIIAAGLAQVRQRGGVPPVILCCDNVNSNGATLRQAVIDLAALKGDDLLAAWIETNVQF
FT                   PDTMVDRIVPTATPDDIADACRLLGGIEDRAPISAEPWFQWVIGEFDGPRPRWVAHPGT
FT                   KFVSDVGVFERAKLQMLNGTHMLLAYVGALANLNTVSEAASDDALGRIAARFMRNEQTA
FT                   DVSLDTDELDRYTVDLMQRFRNPGIVHEVTRIGRNGSAKMASRIVQPMRSNIEAGRPVD
FT                   GAVLLIASWIRWFALHEQDEFDIALTDPRAETLRGLCADARDDHKAQAEAFLAMEEVFG
FT                   APLPDHGKQVEAIASMLRRLTEESVPELLRTIAH"
FT                   /protein_id="YP_003189174.1"
FT   misc_feature    5390..6820
FT                   /note="Mannitol-1-phosphate/altronate dehydrogenases
FT                   [Carbohydrate transport and metabolism]; Region: MtlD;
FT                   COG0246"
FT                   /db_xref="CDD:30595"
FT                   /locus_tag="APA01_40070"
FT   misc_feature    5435..5923
FT                   /note="Mannitol dehydrogenase Rossmann domain; Region:
FT                   Mannitol_dh; pfam01232"
FT                   /db_xref="CDD:144722"
FT                   /locus_tag="APA01_40070"
FT   misc_feature    6008..6745
FT                   /note="Mannitol dehydrogenase C-terminal domain; Region:
FT                   Mannitol_dh_C; pfam08125"
FT                   /db_xref="CDD:149275"
FT                   /locus_tag="APA01_40070"
FT   gene            complement(6908..7621)
FT                   /db_xref="GeneID:8426500"
FT                   /locus_tag="APA01_40080"
FT   CDS_pept        complement(6908..7621)
FT                   /locus_tag="APA01_40080"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatase/phosphohexomutase"
FT                   /transl_table="11"
FT                   /note="HAD-superfamily hydrolase"
FT                   /db_xref="GI:258512918"
FT                   /db_xref="GeneID:8426500"
FT                   /translation="MTDTVFPAHLLKHKQEPVHGVVFDMDGLLLDSESLAMEALVFAAR
FT                   DLNYDIPMSFCRTMIGVPADGCRTMVRKTYGQDFPLERFFELQEVHLRNFVDTGKLALK
FT                   KGVLPLLDLLDTYKIPRAIATSSSRVRTDHHLKLVNLFHRFNAIVTRDDVSKGKPDPEP
FT                   YLTAAKKIGVNPAHALALEDSHSGARAAHAAGIRVIVVPDLLEATDEIRGKALAIVQDL
FT                   SIVEAYLKHAITGQA"
FT                   /protein_id="YP_003189175.1"
FT   misc_feature    complement(<7073..7576)
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="APA01_40080"
FT   misc_feature    complement(7073..7561)
FT                   /note="haloacid dehalogenase-like hydrolase; Region:
FT                   Hydrolase; pfam00702"
FT                   /db_xref="CDD:144342"
FT                   /locus_tag="APA01_40080"
FT   gene            8327..8710
FT                   /db_xref="GeneID:8426501"
FT                   /locus_tag="APA01_40090"
FT   CDS_pept        8327..8710
FT                   /locus_tag="APA01_40090"
FT                   /gene_family="HOG000250463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512919"
FT                   /db_xref="GeneID:8426501"
FT                   /translation="MRRDMDLVRQLLLKLEGIEKGPHDVLLIGGNSEEVAVDGRTSDEI
FT                   YFHLTKIEEAGFLERVGGGAMTAVTFRALSWKGQEFLDTIRDDSIWKKTKEKAGSASFD
FT                   ILAAVAKAVIKDRIKSLTGLDIG"
FT                   /protein_id="YP_003189176.1"
FT   misc_feature    8330..8635
FT                   /note="Hypothetical protein (DUF2513); Region: DUF2513;
FT                   pfam10711"
FT                   /db_xref="CDD:151204"
FT                   /locus_tag="APA01_40090"
FT   gene            complement(9001..9363)
FT                   /db_xref="GeneID:8426502"
FT                   /locus_tag="APA01_40100"
FT   CDS_pept        complement(9001..9363)
FT                   /locus_tag="APA01_40100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512920"
FT                   /db_xref="GeneID:8426502"
FT                   /translation="MRPLGSGLSVRTYGCSEADDQENDGWAKKDTGEIVALYEMSSPVM
FT                   PSGLVSISRWKIKGCYPKSGLSRAMLCPTKIPQSASNIALLIGSDWSFIEENVFCNHIE
FT                   WQTCLPVFVMNLDHPA"
FT                   /protein_id="YP_003189177.1"
FT   gene            9426..13385
FT                   /db_xref="GeneID:8426503"
FT                   /locus_tag="APA01_40110"
FT   CDS_pept        9426..13385
FT                   /locus_tag="APA01_40110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA helicase superfamily I"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512921"
FT                   /db_xref="GeneID:8426503"
FT                   /translation="MSSKPSHHSVLSYWHSALLDDAQMKISFSRDNLVALDEEGFEKGK
FT                   LPPDKTQALRKMHPASRDLAPDDSIIAMAGIRILLGQVSHSTEHSKQPALFCMAMLVNV
FT                   SPEGTIQPLKDAPPWINRELLEPSDGDVLIGDLATMDTWLQLNPFEGGSLGKTLEWAEK
FT                   LWNAVTGEDGLPDGYELWERVALQPAEASIGMIATLHQRRFYDTVLADTGLVTPLLARY
FT                   IDGGPEPAVVDESQKWAAAGRARGTMTFAYGMSSSQSEAMTAFCSVKDGDILAVNGPPG
FT                   TGKTTLLQGIVATELVTRALEGGDPAVIVGTSTNNQAVTNIIDAMKKAMASKDSRPWAR
FT                   RWIEGADALGLYFPSGEKEKEALKAGYLIASPGRGLGTMEWKGFPERERDTVDAWASRD
FT                   AWINGYYGSFYPGVTPPLRKEHLSGHGPQGARHDISLVEDGIAKIRARMKVLVETGRVC
FT                   AGEARKLNQLYVASGYGTYPDITKAIAQREALLQERRPREDALKSDLKEKEAAAAVPRA
FT                   RINEENRKTRDLLKQRDDAVHAAGQKVEEVGAHAVALIAALPGGGFFSNLMSGRNWANV
FT                   ERLVAEGRQGSFFRSLMQAQVKSKREWMDAINEMTASAERELATVRESREETRQARDTL
FT                   IQKLEREVAAADLVSKTARAEYDHYVGGSYVLAGRELEKLVTLKHQILQQLQDCCTAIE
FT                   TVLAPSDWAAMFDMPEEKLPWRQSNWTGRLDVIEDFLDRTIRYALFQYALRYWEGRWVL
FT                   EVQALQDALEQNDNKVYPFKVGGRAMEAMYRRWAMLTPLFIVTAASLPKFPKCTMMEKG
FT                   KFVERFMAGFFDLLIVDEAGQIAPYQMVPAMAFSKKAVVVGDVFQIEPVVTSSHATDTG
FT                   NARKAGVQEYFWDDDGPVDPRVVTAAPGNNNIMGSVMRVVQTGTSHSSPDSPVPGIFLT
FT                   EHRRCRRDIIEICNELVYNGRLKPMTAEPDREPSLPPLAWANVNGTSERLGRSQRNPRE
FT                   AEAIARWIVSKADEWKDFYDKPVNEIVAVIAPYGPQRDAIRRALRKFSTAHTDKNISKI
FT                   KVGTVNAMQGAERDIIIFSPTCDRKASTGFLDGKRSLLNVAISRAVHSFVVIGTMEIFE
FT                   RNPASALGILGRALFSKGYELGDVTGNWAADTSLILRGKRLSSVSEHHAQLDKALADLK
FT                   DGEEIVIVSPFLSLSGVNAPELQDSIREAVGRGAVVNIVTRAPNAPGYSNGTSPACRKA
FT                   LEETGARLHDIKLLHSKTLMTQSFIAEGSFNWLSVMRDKPEGANLDTSWVLTGEDAHKA
FT                   AREAIDELNLLLKESKPPSEIGHGIMAAFVSQGKD"
FT                   /protein_id="YP_003189178.1"
FT   misc_feature    <10185..>10397
FT                   /note="DNA helicase, putative; Region: TIGR00376"
FT                   /db_xref="CDD:161845"
FT                   /locus_tag="APA01_40110"
FT   misc_feature    <11892..12755
FT                   /note="Superfamily I DNA and RNA helicases and helicase
FT                   subunits [DNA replication, recombination, and repair];
FT                   Region: COG1112"
FT                   /db_xref="CDD:31309"
FT                   /locus_tag="APA01_40110"
FT   misc_feature    <12702..13328
FT                   /note="Phosphatidylserine/phosphatidylglycerophosphate/car
FT                   diolipin synthases and related enzymes [Lipid metabolism];
FT                   Region: Cls; COG1502"
FT                   /db_xref="CDD:31691"
FT                   /locus_tag="APA01_40110"
FT   gene            14318..15757
FT                   /db_xref="GeneID:8426504"
FT                   /locus_tag="APA01_40120"
FT   CDS_pept        14318..15757
FT                   /locus_tag="APA01_40120"
FT                   /gene_family="HOG000010160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="GI:258512922"
FT                   /db_xref="GeneID:8426504"
FT                   /translation="MKKSVLHKRNFHNHQENPMQTECSAGAYEFPASCGRRVVARFDGG
FT                   RMSSDGGVILVKQADDILGLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDL
FT                   NDHDALRHDLIFGLASGRLSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALA
FT                   TLFVTLFLDQHEHAPARIVLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLL
FT                   SATLRTTDRDPGKEALADIRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDF
FT                   LFGLAGNTRLYDRIASLSAEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWR
FT                   HGNRYHRFIVTTLPQGMSDPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQ
FT                   LRLWFSAAAYVLLTALQRLALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLFMPDM
FT                   FPCQHEFALAHARLRRLRQAI"
FT                   /protein_id="YP_003189179.1"
FT   misc_feature    14855..15550
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="APA01_40120"
FT   gene            16032..16460
FT                   /db_xref="GeneID:8426505"
FT                   /locus_tag="APA01_40130"
FT   CDS_pept        16032..16460
FT                   /locus_tag="APA01_40130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512923"
FT                   /db_xref="GeneID:8426505"
FT                   /translation="MQKEAKGDLAKDEKADARYLEAKEKSILDIKVSVGKTVFNSNGQV
FT                   VPTTVKNKELHMSEAELDKLIRDLLNTQEDRCAITGLPFQFLGVKKDDNMLPSLDRIDS
FT                   DGHYAKGNLQLVCRFINFWKQASDDKEFRRLLAILRKS"
FT                   /protein_id="YP_003189180.1"
FT   gene            complement(16677..18047)
FT                   /db_xref="GeneID:8426506"
FT                   /locus_tag="APA01_40140"
FT   CDS_pept        complement(16677..18047)
FT                   /locus_tag="APA01_40140"
FT                   /gene_family="HOG000251214" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512924"
FT                   /db_xref="GeneID:8426506"
FT                   /translation="MAADELTGLIRYLGQEDWQECFGEVLGDHIGPALEAGDITFEDLA
FT                   EMIGPDVAMTLWGCAFEDFLGQDWDDSRNFVDVYLKRRGWKEGPRNSAYMRALKASVMS
FT                   LYEVSDIKPGQSLMARDLLRGGDPVLVHEGTATRTLEQWDRIAARLVLSDGKTILAGGL
FT                   LAYSRGACEDLATHLYKVLRKRRGKAEFPKVDTQTLRELAPMFTLTWLFRTLEDMARQM
FT                   EGPALFNGDGEDLVFHEVCFPLAKGVTQKTVADVLDGIMALRPENRSFWNWLKEPMSDP
FT                   VRKAGRDENGRFLRTEMDDGAIVLGTLDLKGRQLRLQVNSKERAERGRAMLQVGLGDLV
FT                   HAPFTQIMTPAQAMEDRGTHGREVSPELQIPPEEEARIIGQMLERHYRQVLDEPVPALG
FT                   DLTPRQAVQTASGRKKVAIWLKDIENTTVRAQGSGGAMAAYDFGWMWHELGIIRLRK"
FT                   /protein_id="YP_003189181.1"
FT   gene            18486..18815
FT                   /db_xref="GeneID:8426507"
FT                   /locus_tag="APA01_40150"
FT   CDS_pept        18486..18815
FT                   /locus_tag="APA01_40150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512925"
FT                   /db_xref="GeneID:8426507"
FT                   /translation="MDCLSRDPEDTKSIECKSVAHDSGEKQHVAAASYSRTLPNQNIAY
FT                   HEIIDISHDCTRLALFRQLWGGNGRSAIGRKIRQVAIRAFNVHDNFAPNFDADFSHLRQ
FT                   FRVIL"
FT                   /protein_id="YP_003189182.1"
FT   gene            complement(18958..20343)
FT                   /db_xref="GeneID:8426508"
FT                   /locus_tag="APA01_40160"
FT   CDS_pept        complement(18958..20343)
FT                   /locus_tag="APA01_40160"
FT                   /gene_family="HOG000010160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="GI:258512926"
FT                   /db_xref="GeneID:8426508"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPAFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHERAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYIFCGDHLLSATLRTADRDPGNEALAD
FT                   ISRIVEQIRNRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT                   /protein_id="YP_003189183.1"
FT   misc_feature    complement(19165..19860)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="APA01_40160"
FT   gene            20552..21010
FT                   /db_xref="GeneID:8426509"
FT                   /locus_tag="APA01_40170"
FT   CDS_pept        20552..21010
FT                   /locus_tag="APA01_40170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512927"
FT                   /db_xref="GeneID:8426509"
FT                   /translation="MKERATSAPEINSEEVQHLLASTVSLTDQRLVNQIRGMVEDMRSG
FT                   VADPEHPDFLFSIEQLERAVSGAQNVNEPQSSSDTRPTDETRPGLHPSPGGGHAEENNP
FT                   SADQTTPQKEGSRTEPQNAEQAKKEPAGTDKAQSTDKKEPEAQKEPEG"
FT                   /protein_id="YP_003189184.1"
FT   misc_feature    <20627..>20767
FT                   /note="Domain Homologous to E6-AP Carboxyl Terminus with;
FT                   Region: HECTc; smart00119"
FT                   /db_xref="CDD:128427"
FT                   /locus_tag="APA01_40170"
FT   gene            21076..21339
FT                   /db_xref="GeneID:8426510"
FT                   /locus_tag="APA01_40180"
FT   CDS_pept        21076..21339
FT                   /locus_tag="APA01_40180"
FT                   /gene_family="HOG000266653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512928"
FT                   /db_xref="GeneID:8426510"
FT                   /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKY
FT                   GGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
FT                   /protein_id="YP_003189185.1"
FT   misc_feature    21088..21291
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="APA01_40180"
FT   gene            21336..22163
FT                   /db_xref="GeneID:8426511"
FT                   /locus_tag="APA01_40190"
FT   CDS_pept        21336..22163
FT                   /locus_tag="APA01_40190"
FT                   /gene_family="HOG000118482" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="Integrase core domain"
FT                   /db_xref="GI:258512929"
FT                   /db_xref="GeneID:8426511"
FT                   /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAE
FT                   NDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGHVWNHKRVYRIYRELELNLRIKPRRRL
FT                   VREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLPACR
FT                   VVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERY
FT                   NRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
FT                   /protein_id="YP_003189186.1"
FT   misc_feature    21687..22025
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="APA01_40190"
FT   gene            22224..22886
FT                   /db_xref="GeneID:8426512"
FT                   /locus_tag="APA01_40200"
FT   CDS_pept        22224..22886
FT                   /locus_tag="APA01_40200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512930"
FT                   /db_xref="GeneID:8426512"
FT                   /translation="MSMGAALVGGFSRLAGALATKLEAEPGKLSPGWLDRAREKSQRHD
FT                   AAQAEKNMDHTAHLGSEAVEAMQALRQGPGSSILAAIAEAAASDPGGMSAVLSEMKPGG
FT                   KYASLHGQFEAEKQNNQAFASSLENAASKLDAYGKGREAAQKLGETMSTSTRVEQRFAQ
FT                   IDAQIGKEAESLPGSNPGTSMMEELGEKTKELVKKAVETLARLFRAAPSSGPTMSPG"
FT                   /protein_id="YP_003189187.1"
FT   gene            22900..25275
FT                   /db_xref="GeneID:8426513"
FT                   /locus_tag="APA01_40210"
FT   CDS_pept        22900..25275
FT                   /locus_tag="APA01_40210"
FT                   /gene_family="HOG000057770" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512931"
FT                   /db_xref="GeneID:8426513"
FT                   /translation="MTVRGFLASVFMVLGLALYVSSAMAQSGSVTGSTTQSTMSGSSSE
FT                   ASSSHTVTWDLLDPGDDWTAVVVRSIFPVFSSGDSSIGSENTVIGTMLAWLSAFAGVIA
FT                   SGWVTYLWFNTNFRGAETAKLLGDNQSQMSIVKIGLAALMMFPTISGFNGGQAVVVQGS
FT                   LWGIGMAKTIYHYAVKAIGPDGKVIATPIVPGTKGIVLNLVKDEFCRSLLNVASNNPNL
FT                   IPAPTGRTIQGISGQSIGLVVNYAYNMTLGDGTPTCGAINLETPAMGKTNLAGVSVDTA
FT                   AMQKNVLDAVLAADIRGPVETVARNFWMSKKTQDLAPLMQIVMTATNDYTSRLTEQAAQ
FT                   MRSQLEKAISDRSTTLNQWGLGTNGDATNTANRLDSLGWSGAGAYYLEFARLNGQTLSL
FT                   MTATPNVTTPSYSGIGSALASDVAPLIQSAHTFLGNIDAMVATTDGMSAPGGNGDLYSG
FT                   AMPGGDGSSVVTQLFRALHLNDYALQMLVGFMEPSGTGGYWIDPFGNLMSLGHWLITLS
FT                   VTTMGTASVLSSNAGTISTGILSLLAGQPEGAVAAGLGHMAMQFFSTPIMAGCMAMLML
FT                   MPGLTIAFVLPMVPYVMWIAGIASWLILVCEAVVAAPLWMLAHMTLNGEGLHGNARQGY
FT                   ALLFDVLFRPTLMLFGLFFGYFVFDAMSWLVHQTFGVAAGFALSHGWLVSNFLGMLLLV
FT                   WMFVLLHMILALASFRLIAIVPNRVPQILGFGGGERIDVDAFSRDVAVIGMAGAMQNMQ
FT                   KALAPPERQQGNGNGISAPQKEIEKGTGLIDTTLKKNS"
FT                   /protein_id="YP_003189188.1"
FT   gene            25293..25694
FT                   /db_xref="GeneID:8426514"
FT                   /locus_tag="APA01_40220"
FT   CDS_pept        25293..25694
FT                   /locus_tag="APA01_40220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512932"
FT                   /db_xref="GeneID:8426514"
FT                   /translation="MSDSGLGAFAAYMLGHNAGSAAERNSRFIRSIFDRSNAADYDEVL
FT                   KLARKGVSAVKTLGERLDTLNAELAAEREKSATLEEQLAAANAANAELQRRLEAEKAHA
FT                   VMLDDRLFDLTRRHVRLCKQTGMTETSST"
FT                   /protein_id="YP_003189189.1"
FT   gene            complement(26101..26721)
FT                   /db_xref="GeneID:8426515"
FT                   /locus_tag="APA01_40230"
FT   CDS_pept        complement(26101..26721)
FT                   /locus_tag="APA01_40230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512933"
FT                   /db_xref="GeneID:8426515"
FT                   /translation="MSEHDNSFQASQKKGVIKTTAKLAKHVTGSPSDAVGWRQISGNFN
FT                   VIRLLWTILKLSAKPEPHKDEGKVPNPPSLQDDDHELIEDARNDIVGKKPLPAIRSAIP
FT                   YRYLTDDDLYNVIRKRQRETFFRALCAGLLTIVLFIMWSTEMIFFPWTSSRLLSSVAFL
FT                   PFLALLGSVSLWNCSVNWQLRTRQIATFREFLDRADSLLPRLP"
FT                   /protein_id="YP_003189190.1"
FT   gene            complement(26718..27725)
FT                   /db_xref="GeneID:8426516"
FT                   /locus_tag="APA01_40240"
FT   CDS_pept        complement(26718..27725)
FT                   /locus_tag="APA01_40240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiol:disulfide interchange protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258512934"
FT                   /db_xref="GeneID:8426516"
FT                   /translation="MLRFYPLALTLILLEPTVTQAQQCSIASNGTSSAPSPSLPPKRQS
FT                   NPSDSYDALNRLTGSGAHLASPGQFHGFETGAAYTPDRVFIYFLLKDHRGVLGGTAIPV
FT                   PYDTLRSLSGKRATDLAQWHGIRGMFLQNGSHFQVIYATPDGQAAVAGSLWDASGRDVT
FT                   RQQIQHIPGAVPSVRMDGAQITKTVLASLHGGTVGSLSAPSAVMLIDPQCMYSIKAAQN
FT                   LMPLVQAGKLRLKVVPLSVLDYEDRGESTRNAQAMLSYPETDMVRAWLGGHLHERADTP
FT                   ASNAASQLAENGTFAKSIALKGTPTFLWIRTDGSLGRLEGNPTDVSSFLGELAR"
FT                   /protein_id="YP_003189191.1"
FT   misc_feature    complement(26778..27353)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="APA01_40240"
FT   gene            complement(27766..28143)
FT                   /db_xref="GeneID:8426517"
FT                   /locus_tag="APA01_40250"
FT   CDS_pept        complement(27766..28143)
FT                   /locus_tag="APA01_40250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugal exonuclease V alpha subunit TraA"
FT                   /transl_table="11"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="GI:258512935"
FT                   /db_xref="GeneID:8426517"
FT                   /translation="MHEEFYRGFSSLALLAKEDLPTCVREAIVFLEKHICRVIPDCPHP
FT                   ILRSSLVLTLSFPREQWVHLIEVIKWYRRRATPSERRLISRFLKIVRPILPEATPEPFH
FT                   WIPPASLINCSSNKKKQSVAS"
FT                   /protein_id="YP_003189192.1"
FT   gene            28613..29998
FT                   /db_xref="GeneID:8426518"
FT                   /locus_tag="APA01_40260"
FT   CDS_pept        28613..29998
FT                   /locus_tag="APA01_40260"
FT                   /gene_family="HOG000010160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="DDE (Asp,Asp,Glu) domain"
FT                   /db_xref="GI:258512936"
FT                   /db_xref="GeneID:8426518"
FT                   /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDIL
FT                   GLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLASGR
FT                   LSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHEHAPARI
FT                   VLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKEALAD
FT                   IRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLS
FT                   AEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMS
FT                   DPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQR
FT                   LALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLR
FT                   QAI"
FT                   /protein_id="YP_003189193.1"
FT   misc_feature    29096..29791
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="APA01_40260"
FT   gene            30213..30710
FT                   /db_xref="GeneID:8426519"
FT                   /locus_tag="APA01_40270"
FT   CDS_pept        30213..30710
FT                   /locus_tag="APA01_40270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase"
FT                   /transl_table="11"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="GI:258512937"
FT                   /db_xref="GeneID:8426519"
FT                   /translation="MRITLPHSKGDKKHQGTTIVIPRGITRHCPVRAWETWLRQSKLTP
FT                   RNKNKDTKPENVNETTAAFPRIWLPAAAKNNEPPPAPKIGMKSLSDWSVAKIIKQRCQS
FT                   AGIEGDFSGHSLRRGAITTGAQDGLDLIRLKRFSRHRDYRVLEAYIEEDQALSKHPGKT
FT                   RF"
FT                   /protein_id="YP_003189194.1"
FT   misc_feature    <30213..30686
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="APA01_40270"
FT   misc_feature    order(30237..30239,30546..30554,30657..30659)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="APA01_40270"
FT   misc_feature    order(30237..30239,30552..30554,30561..30563,30630..30632,
FT                   30657..30659)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="APA01_40270"
FT   misc_feature    order(30552..30554,30561..30563,30630..30632,30657..30659)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="APA01_40270"
FT   gene            31135..32058
FT                   /db_xref="GeneID:8426520"
FT                   /locus_tag="APA01_40280"