(data stored in ACNUC30567 zone)

HOGENOMDNA: ACEP3_3

ID   ACEP3_3; SV 1; empty ; DNA; empty ; PRO; 182940 BP.
XX
AC   NC_013211;
XX
PR   Project: 59279;
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-020, complete
DE   sequence.
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
XX
RN   [1]
RP   1-182940
RX   PUBMED; 19638423.
RA   Azuma,Y., Hosoyama,A., Matsutani,M., Furuya,N., Horikawa,H., Harada,T.,
RA   Hirakawa,H., Kuhara,S., Matsushita,K., Fujita,N. and Shirai,M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37 (17), 5768-5783 (2009)
XX
RN   [2]
RP   1-182940
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-SEP-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-182940
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma,Y. and Hosoyama,A.;
RT   "Direct Submission";
RL   Submitted (06-APR-2009) Contact:Yoshinao Azuma Yamaguchi University School
RL   of Medicine, Department of Microbiology and Immunology; Minami-Kogushi
RL   1-1-1, Ube, Yamaguchi 755-8505, Japan URL
RL   :http://www.bio.nite.go.jp/dogan/Top
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to AP011123.
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty of
CC   Agriculture, Kyushu University, Department of Biological Chemistry,
CC   Faculty of Agriculture, Yamaguchi University and Mizkan Group
CC   Corporation Central Research Institute.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..182940
FT                   /mol_type="genomic DNA"
FT                   /db_xref="NBRC:105184"
FT                   /db_xref="taxon:634452"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /strain="IFO 3283"
FT                   /plasmid="pAPA01-020"
FT                   /sub_strain="IFO 3283-01"
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT   gene            20..256
FT                   /db_xref="GeneID:8426845"
FT                   /locus_tag="APA01_41790"
FT   CDS_pept        20..256
FT                   /locus_tag="APA01_41790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513089"
FT                   /db_xref="GeneID:8426845"
FT                   /translation="MKGPAFLMAMDTVIGGIHIQNDPGGCALMLVHEERDEQGSQGLMI
FT                   SNDAAVTICLVATALQPVQRGFSCQCCAVCPAS"
FT                   /protein_id="YP_003189345.1"
FT   gene            290..586
FT                   /db_xref="GeneID:8426672"
FT                   /locus_tag="APA01_41800"
FT   CDS_pept        290..586
FT                   /locus_tag="APA01_41800"
FT                   /gene_family="HOG000158433" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513090"
FT                   /db_xref="GeneID:8426672"
FT                   /translation="MPQGIVIIEIFIAQCQAHDPLTDKVFNPVFHKAGMPLIAKTGSKA
FT                   AAETQNVISLLHQNDAPIRTHATPVKTGHNTPSTGGWKFIRACATLCLHRVFL"
FT                   /protein_id="YP_003189346.1"
FT   gene            680..973
FT                   /db_xref="GeneID:8426673"
FT                   /locus_tag="APA01_41810"
FT   CDS_pept        680..973
FT                   /locus_tag="APA01_41810"
FT                   /gene_family="HOG000157656" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513091"
FT                   /db_xref="GeneID:8426673"
FT                   /translation="MDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQRLALGQTSLET
FT                   ATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLRQAI"
FT                   /protein_id="YP_003189347.1"
FT   gene            complement(1139..1738)
FT                   /db_xref="GeneID:8426674"
FT                   /locus_tag="APA01_41820"
FT   CDS_pept        complement(1139..1738)
FT                   /locus_tag="APA01_41820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type I endonuclease restriction R subunit"
FT                   /transl_table="11"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="GI:258513092"
FT                   /db_xref="GeneID:8426674"
FT                   /translation="MSFLSENEIEDWACDILRECGYTIAWGPDIAPGGKKPERASLSDV
FT                   VLEKRLRTTINKLNPHLPQASKDEALLALMREDTPDHVDENRRLHDYLVNGVPVDVVRK
FT                   DGTQSGDRVRLLDFENPENNDFLVVRQFVVEKDEANRRPDLVLFVNGMPLGVVELKSPS
FT                   SESATLDSAWNQFQTYRSFIPSLFRFNEALTRISHT"
FT                   /protein_id="YP_003189348.1"
FT   misc_feature    complement(<1160..1732)
FT                   /note="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit and related helicases
FT                   [Defense mechanisms]; Region: COG0610"
FT                   /db_xref="CDD:30955"
FT                   /locus_tag="APA01_41820"
FT   misc_feature    complement(<1163..1375)
FT                   /note="Type I restriction enzyme R protein N terminus
FT                   (HSDR_N); Region: HSDR_N; cl01057"
FT                   /db_xref="CDD:154173"
FT                   /locus_tag="APA01_41820"
FT   gene            complement(1735..2079)
FT                   /db_xref="GeneID:8426675"
FT                   /locus_tag="APA01_41830"
FT   CDS_pept        complement(1735..2079)
FT                   /locus_tag="APA01_41830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type I DNA specificity S subunit"
FT                   /transl_table="11"
FT                   /note="Probably pseudogene, C-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="GI:258513093"
FT                   /db_xref="GeneID:8426675"
FT                   /translation="MTTNQAISSLIPKGIGKSYIFLHMLHSKVNLANKATGSAQQNLSK
FT                   NLIETFETLIPNDKILYEFENKTSLLFDKIIKNFDEPHILAQLRDLLLPKLMSGEISIR
FT                   DAEKMVEDAA"
FT                   /protein_id="YP_003189349.1"
FT   gene            complement(2326..2700)
FT                   /db_xref="GeneID:8426676"
FT                   /locus_tag="APA01_41840"
FT   CDS_pept        complement(2326..2700)
FT                   /locus_tag="APA01_41840"
FT                   /gene_family="HOG000254172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513094"
FT                   /db_xref="GeneID:8426676"
FT                   /translation="MIADGHGKAFGFALAPGQAHELPLAPAMLDSLPATPLWVVADKGY
FT                   ASNAMRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLVENLWARLKEWRAVATRYEK
FT                   TATSFLAVIHIAAAADWIKP"
FT                   /protein_id="YP_003189350.1"
FT   misc_feature    complement(2338..2697)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="APA01_41840"
FT   gene            complement(2697..3122)
FT                   /db_xref="GeneID:8426677"
FT                   /locus_tag="APA01_41850"
FT   CDS_pept        complement(2697..3122)
FT                   /locus_tag="APA01_41850"
FT                   /gene_family="HOG000254172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513095"
FT                   /db_xref="GeneID:8426677"
FT                   /translation="MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIFW
FT                   RHENGAKWRSIPAELGPWWRAAQLFIRWAKLGVWERLLALVQEQQGVAFGMTFLDGTNI
FT                   RAHHKAAGAQKKGPLSKSETIVKHLAALAAAMAQKSA"
FT                   /protein_id="YP_003189351.1"
FT   misc_feature    complement(<2829..3092)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="APA01_41850"
FT   gene            complement(3144..3854)
FT                   /db_xref="GeneID:8426678"
FT                   /locus_tag="APA01_41860"
FT   CDS_pept        complement(3144..3854)
FT                   /locus_tag="APA01_41860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type I DNA specificity S subunit"
FT                   /transl_table="11"
FT                   /note="Probably pseudogene, N-terminal domain of a gene
FT                   truncated by transposon"
FT                   /db_xref="GI:258513096"
FT                   /db_xref="GeneID:8426678"
FT                   /translation="MLMEASKLVLYGTQLHASDYVTSGVPCIMPQDIIDGKISTGKIAY
FT                   ISEENANRLSNFRLAQNDIIYPRRGDITKHALITSRENGWLCGTGCLRIRLNTSSILPQ
FT                   YLYYYLTLPHVKEWISQNSVGATMPHLNTSLVGQISVSYPTYDEQHTIASILGSLDDKI
FT                   ELNRRTNETLEAMARALFRDWFVDFGPTRAKMAGEAPYLAPELWELFPGRLDNEGKPEG
FT                   WKIGELHELGPVRS"
FT                   /protein_id="YP_003189352.1"
FT   misc_feature    complement(3330..>3743)
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="APA01_41860"
FT   gene            complement(3925..4245)
FT                   /db_xref="GeneID:8426679"
FT                   /locus_tag="APA01_41870"
FT   CDS_pept        complement(3925..4245)
FT                   /locus_tag="APA01_41870"
FT                   /gene_family="HOG000029676" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase beta subunit like
FT                   nucleotidyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513097"
FT                   /db_xref="GeneID:8426679"
FT                   /translation="MTGLIEITPEERAIVLRILNEIVPDREVRAFGSRVTGKAKLFSDL
FT                   DLAIMGDEPLLLETRARLEEAFSESELPWKVDVLDWALADKMFQDIIMKTSLVFRKQQK
FT                   RF"
FT                   /protein_id="YP_003189353.1"
FT   misc_feature    complement(<4003..4218)
FT                   /note="Nucleotidyltransferase (NT) domain of Staphylococcus
FT                   aureus kanamycin nucleotidyltransferase, and similar
FT                   proteins; Region: NT_KNTase_like; cd05403"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="APA01_41870"
FT   misc_feature    complement(order(4015..4017,4021..4023,4108..4110,
FT                   4114..4119,4138..4140,4147..4155))
FT                   /note="active site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="APA01_41870"
FT   misc_feature    complement(order(4108..4110,4114..4119,4138..4140,
FT                   4147..4155))
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="APA01_41870"
FT   misc_feature    complement(order(4015..4017,4108..4110,4114..4116))
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="APA01_41870"
FT   misc_feature    complement(order(4015..4017,4021..4023))
FT                   /note="antibiotic binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="APA01_41870"
FT   gene            complement(4242..4643)
FT                   /db_xref="GeneID:8426680"
FT                   /locus_tag="APA01_41880"
FT   CDS_pept        complement(4242..4643)
FT                   /locus_tag="APA01_41880"
FT                   /gene_family="HOG000148513" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleotidyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513098"
FT                   /db_xref="GeneID:8426680"
FT                   /translation="MLYLTPLERALNRLKEGWTRHLAHPDDEQLRDGLIQRFEFTYELS
FT                   HKTLKRFLETNSASPDEYDRMGFPDMIRSANEAGLLKSAWPQWSVFRKMRNLTSHTYNE
FT                   ATAKQVVATIPDFIVEAEFLLVTLKERTT"
FT                   /protein_id="YP_003189354.1"
FT   misc_feature    complement(4254..4634)
FT                   /note="Nucleotidyltransferase substrate binding protein
FT                   like; Region: NTase_sub_bind; cl08495"
FT                   /db_xref="CDD:158371"
FT                   /locus_tag="APA01_41880"
FT   gene            complement(4643..6256)
FT                   /db_xref="GeneID:8426681"
FT                   /locus_tag="APA01_41890"