(data stored in ACNUC30567 zone)

HOGENOMDNA: ACEP3_4

ID   ACEP3_4; SV 1; empty ; DNA; empty ; PRO; 49961 BP.
XX
AC   NC_013212;
XX
PR   Project: 59279;
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-030, complete
DE   sequence.
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
XX
RN   [1]
RP   1-49961
RX   PUBMED; 19638423.
RA   Azuma,Y., Hosoyama,A., Matsutani,M., Furuya,N., Horikawa,H., Harada,T.,
RA   Hirakawa,H., Kuhara,S., Matsushita,K., Fujita,N. and Shirai,M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37 (17), 5768-5783 (2009)
XX
RN   [2]
RP   1-49961
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-SEP-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-49961
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma,Y. and Hosoyama,A.;
RT   "Direct Submission";
RL   Submitted (06-APR-2009) Contact:Yoshinao Azuma Yamaguchi University School
RL   of Medicine, Department of Microbiology and Immunology; Minami-Kogushi
RL   1-1-1, Ube, Yamaguchi 755-8505, Japan URL
RL   :http://www.bio.nite.go.jp/dogan/Top
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to AP011124.
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty of
CC   Agriculture, Kyushu University, Department of Biological Chemistry,
CC   Faculty of Agriculture, Yamaguchi University and Mizkan Group
CC   Corporation Central Research Institute.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..49961
FT                   /mol_type="genomic DNA"
FT                   /db_xref="NBRC:105184"
FT                   /db_xref="taxon:634452"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /strain="IFO 3283"
FT                   /plasmid="pAPA01-030"
FT                   /sub_strain="IFO 3283-01"
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT   gene            501..1070
FT                   /db_xref="GeneID:8426909"
FT                   /locus_tag="APA01_43530"
FT   CDS_pept        501..1070
FT                   /locus_tag="APA01_43530"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA resolvase"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513264"
FT                   /db_xref="GeneID:8426909"
FT                   /translation="MFTMAGQIVAYVRVSSADQNTDRQMFDGMTVDKTFTDKCSGGTRN
FT                   RPALTEMLGYVREGDTIVCHSIDRLARDLGDLMHLVQTMTRRGVGVRFMKEGLTFTGED
FT                   SPMQDLMMHIFGAVAQFERALIHERQKEGQIAARAKGKVPGRKPKLSPEQVTELYNRVA
FT                   THEPKAQIARDFGISRETLYAYLKAA"
FT                   /protein_id="YP_003189519.1"
FT   misc_feature    522..1061
FT                   /note="multiple promoter invertase; Provisional; Region:
FT                   mpi; PRK13413"
FT                   /db_xref="CDD:172040"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    522..899
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    order(537..539,543..545,702..707,714..716)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    543..545
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    order(699..701,840..845,849..854,864..866)
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    order(717..719,732..737,828..830,837..842,849..854,
FT                   861..863,870..872)
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    order(786..794,828..833,840..845,852..854,864..866,
FT                   873..875,885..887)
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    order(786..788,843..845,852..854,864..866,873..875,
FT                   885..887)
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    order(867..869,885..890)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    933..1058
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="APA01_43530"
FT   misc_feature    order(936..944,1038..1043,1047..1055)
FT                   /note="DNA-binding interface; DNA binding site"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="APA01_43530"
FT   gene            1194..1433
FT                   /db_xref="GeneID:8426847"
FT                   /locus_tag="APA01_43540"
FT   CDS_pept        1194..1433
FT                   /locus_tag="APA01_43540"
FT                   /gene_family="HOG000225294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513265"
FT                   /db_xref="GeneID:8426847"
FT                   /translation="MSTTRWNIAVSSEVDQSVRMFLAANGGGRKGDLSRFIEDAVRSYL
FT                   LEQAVEQAKAASEDMSEAELADLVNEAVQWARGH"
FT                   /protein_id="YP_003189520.1"
FT   gene            1415..1855
FT                   /db_xref="GeneID:8426848"
FT                   /locus_tag="APA01_43550"
FT   CDS_pept        1415..1855
FT                   /locus_tag="APA01_43550"
FT                   /gene_family="HOG000262558" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513266"
FT                   /db_xref="GeneID:8426848"
FT                   /translation="MGTWALMRVVLDTNILVSALIYPRGAPDAIYRAWRAHRFDLVTST
FT                   TQLEELRRVSRYPKLRSILPPHRVGAMINNMRKASVAEQLPTLPDDVTINDRDDVFLLT
FT                   MVLAFDADYLVTGDHRAGLLEKGRFQRARIVTPVDFCSIALD"
FT                   /protein_id="YP_003189521.1"
FT   misc_feature    1433..1849
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:175014"
FT                   /locus_tag="APA01_43550"
FT   gene            complement(1949..2206)
FT                   /db_xref="GeneID:8426849"
FT                   /locus_tag="APA01_43560"