(data stored in ACNUC30567 zone)

HOGENOMDNA: ACEP3_5

ID   ACEP3_5; SV 1; empty ; DNA; empty ; PRO; 3204 BP.
XX
AC   NC_013213;
XX
PR   Project: 59279;
XX
DE   Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-040, complete
DE   sequence.
XX
OS   Acetobacter pasteurianus IFO 3283-01
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
OC   Acetobacteraceae; Acetobacter.
XX
RN   [1]
RP   1-3204
RX   PUBMED; 19638423.
RA   Azuma,Y., Hosoyama,A., Matsutani,M., Furuya,N., Horikawa,H., Harada,T.,
RA   Hirakawa,H., Kuhara,S., Matsushita,K., Fujita,N. and Shirai,M.;
RT   "Whole-genome analyses reveal genetic instability of Acetobacter
RT   pasteurianus";
RL   Nucleic Acids Res. 37 (17), 5768-5783 (2009)
XX
RN   [2]
RP   1-3204
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-SEP-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3204
RG   Acetobacter pasteurianus genome sequencing consortium
RA   Azuma,Y. and Hosoyama,A.;
RT   "Direct Submission";
RL   Submitted (06-APR-2009) Contact:Yoshinao Azuma Yamaguchi University School
RL   of Medicine, Department of Microbiology and Immunology; Minami-Kogushi
RL   1-1-1, Ube, Yamaguchi 755-8505, Japan URL
RL   :http://www.bio.nite.go.jp/dogan/Top
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to AP011125.
CC   This work was done by Acetobacter pasteurianus genome sequencing
CC   consortium including Department of Microbiology and Immunology,
CC   Yamaguchi University School of Medicine, National Institute of
CC   Technology and Evaluation, Genetic Resources Technology, Faculty of
CC   Agriculture, Kyushu University, Department of Biological Chemistry,
CC   Faculty of Agriculture, Yamaguchi University and Mizkan Group
CC   Corporation Central Research Institute.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3204
FT                   /mol_type="genomic DNA"
FT                   /db_xref="NBRC:105184"
FT                   /db_xref="taxon:634452"
FT                   /note="strain coidentity: IFO 3283 = NBRC 3283"
FT                   /strain="IFO 3283"
FT                   /plasmid="pAPA01-040"
FT                   /sub_strain="IFO 3283-01"
FT                   /organism="Acetobacter pasteurianus IFO 3283-01"
FT   gene            complement(116..562)
FT                   /db_xref="GeneID:8426913"
FT                   /locus_tag="APA01_44160"
FT   CDS_pept        complement(116..562)
FT                   /locus_tag="APA01_44160"
FT                   /gene_family="HOG000061710" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258513328"
FT                   /db_xref="GeneID:8426913"
FT                   /translation="MASFRIETHIANLRQLEKPSTEQRILILLYDKTDRTPKEERDLKA
FT                   LIRSEKAQEAVKEAKAKASEAKARSSKIAKRERDAKDKERTHNLIQSAGLLILAGLVDS
FT                   KTGNPTWDKGELLGALASMAKAEINDTKRQEWKEKGDALLAGEK"
FT                   /protein_id="YP_003189582.1"
FT   misc_feature    complement(122..328)
FT                   /note="Conjugal transfer protein TraD; Region: TraD;
FT                   cl05753"
FT                   /db_xref="CDD:174850"
FT                   /locus_tag="APA01_44160"
FT   gene            744..2195
FT                   /db_xref="GeneID:8426911"
FT                   /locus_tag="APA01_44170"