(data stored in ACNUC8465 zone)

HOGENOMDNA: ACHXA_1.PE12

ACHXA_1.PE12         Location/Qualifiers
FT   CDS_pept        12298..12681
FT                   /locus_tag="AXYL_00012"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP family protein 1"
FT                   /transl_table="11"
FT                   /db_xref="GI:311103236"
FT                   /db_xref="GeneID:9894344"
FT                   /translation="MIRKAYSSESTPPPAGTYSVAMQAGQLLFLSGQTPRDRDNVRHGD
FT                   KPFAAQARMALDNLEAAANAAGASLRDAVKVGVFLRDLAHAQEFDAIYATYVGEPPPAR
FT                   TLIQSGFSAFDIEVDAILVRSFA"
FT                   /protein_id="YP_003976089.1"
     ATGATCAGAA AAGCGTATTC CAGCGAATCG ACGCCGCCGC CGGCCGGCAC CTACAGCGTG        60
     GCCATGCAGG CTGGCCAACT CCTGTTTCTC TCGGGCCAGA CACCGCGCGA TCGCGACAAC       120
     GTCAGACATG GAGACAAGCC CTTTGCCGCC CAGGCAAGAA TGGCGCTCGA CAATCTCGAG       180
     GCTGCCGCGA ATGCGGCAGG GGCTAGCCTG CGCGACGCAG TCAAGGTGGG TGTGTTCTTG       240
     AGGGACCTGG CCCATGCGCA GGAATTCGAC GCGATCTACG CGACCTATGT TGGGGAACCG       300
     CCGCCTGCCA GGACCTTGAT CCAGTCCGGT TTCAGCGCGT TCGACATCGA GGTCGATGCG       360
     ATACTCGTTC GAAGTTTCGC CTAA                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page