(data stored in ACNUC8465 zone)

HOGENOMDNA: ACHXA_1.PE1266

ACHXA_1.PE1266       Location/Qualifiers
FT   CDS_pept        1361814..1362227
FT                   /locus_tag="AXYL_01290"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP family protein 5"
FT                   /transl_table="11"
FT                   /db_xref="GI:311104490"
FT                   /db_xref="GeneID:9895622"
FT                   /translation="MKHKRIRTFNTKATYPEQKLDNDLCQAVVARGSTVFLRGQIGQNL
FT                   DTSESVCIGDAAGQTEQAMKNIDMLLKEAGGELQDICKITIYIIDPRYREEVYRVVGKW
FT                   LKGVFPVSTGIVVSALARPEWLVEIDATAVIPD"
FT                   /protein_id="YP_003977343.1"
     ATGAAGCATA AGCGCATACG CACCTTCAAT ACCAAGGCGA CCTACCCCGA ACAGAAACTC        60
     GACAACGATC TGTGCCAGGC CGTCGTCGCG CGCGGCAGCA CTGTCTTCTT GCGCGGGCAG       120
     ATCGGCCAGA ACCTGGACAC GTCCGAGAGC GTCTGCATCG GCGATGCCGC AGGCCAGACC       180
     GAGCAGGCGA TGAAGAACAT CGACATGTTG CTCAAGGAGG CCGGCGGCGA ACTGCAGGAC       240
     ATCTGCAAGA TCACGATCTA CATCATCGAC CCCCGTTATC GCGAGGAGGT CTATCGCGTG       300
     GTTGGAAAAT GGCTCAAGGG CGTGTTCCCG GTATCCACCG GCATCGTGGT ATCGGCGCTG       360
     GCGCGTCCCG AATGGCTGGT GGAAATCGAC GCGACTGCCG TTATTCCGGA TTGA             414
//

If you have problems or comments...

PBIL Back to PBIL home page