(data stored in ACNUC8465 zone)

HOGENOMDNA: ACHXA_1.PE1289

ACHXA_1.PE1289       Location/Qualifiers
FT   CDS_pept        complement(1384589..1385005)
FT                   /locus_tag="AXYL_01313"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP family protein 6"
FT                   /transl_table="11"
FT                   /db_xref="GI:311104513"
FT                   /db_xref="GeneID:9895645"
FT                   /translation="MTTIARYPSPLPLPFSRATQAGGFLFLSGQIPMDANGQVVRGDIT
FT                   VQTHAAIERIKETLALAGATLKDVVRVTVWLTDLELFAQFNDAYRSHFSSDFPSRSTVE
FT                   AKLAMGVDVEIEVQAWLGAAATHGGYTPGPVSEA"
FT                   /protein_id="YP_003977366.1"
     atgaccacca tagcccgtta tcccagcccc ctgcccctgc cgttctcccg cgccacccag        60
     gccggcggct ttttgttcct gtcgggccag atcccgatgg acgccaacgg ccaggtcgtg       120
     cgcggcgaca tcaccgtcca gacccatgcc gccatcgagc gcatcaagga aacgctggcc       180
     ttggccggcg ccacgctcaa ggacgtggtg cgcgtcacgg tgtggctgac ggacctggaa       240
     ctgttcgcac agttcaacga cgcctaccgc agccattttt cctctgactt cccctcgcgc       300
     tcgacggtcg aggccaagct ggccatgggc gtggacgtgg agatcgaagt gcaggcctgg       360
     ctgggcgcgg cggcgaccca cggcggctac acgccgggcc cagtgtccga agcctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page