(data stored in ACNUC8465 zone)

HOGENOMDNA: ACHXA_1.PE586

ACHXA_1.PE586        Location/Qualifiers
FT   CDS_pept        630524..630928
FT                   /locus_tag="AXYL_00590"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP family protein 3"
FT                   /transl_table="11"
FT                   /db_xref="GI:311103810"
FT                   /db_xref="GeneID:9894922"
FT                   /translation="MKILQPPDWMAPRGYSNGVLTEMQVGSKLVFVGGQVGWNGQQQFE
FT                   SDDLADQVRQTLANIVAILAEGGAKPEHIVRMTWYVTDKDEYVAAYPAIGKHYREYIGR
FT                   HFPAMTAVEVADLVEDRAKVEIEVTAVVPA"
FT                   /protein_id="YP_003976663.1"
     ATGAAGATTC TGCAACCGCC GGATTGGATG GCGCCCCGGG GCTATTCGAA TGGCGTGCTC        60
     ACCGAGATGC AGGTGGGCAG CAAGCTCGTT TTTGTGGGCG GGCAGGTGGG GTGGAATGGC       120
     CAGCAGCAGT TCGAGTCGGA CGATCTGGCC GATCAGGTGC GGCAGACGCT GGCGAACATC       180
     GTCGCGATTC TGGCCGAGGG CGGCGCGAAG CCTGAGCATA TCGTCCGGAT GACGTGGTAC       240
     GTGACGGATA AGGACGAGTA CGTGGCGGCT TATCCGGCTA TCGGCAAGCA TTACCGCGAG       300
     TACATCGGCC GGCATTTTCC GGCGATGACG GCGGTGGAAG TGGCGGATCT GGTTGAGGAT       360
     CGGGCCAAGG TTGAGATCGA GGTTACTGCT GTGGTGCCGG CGTAG                       405
//

If you have problems or comments...

PBIL Back to PBIL home page