(data stored in ACNUC8465 zone)

HOGENOMDNA: ACIB4_1

ID   ACIB4_1; SV 1; empty ; DNA; empty ; PRO; 1486778 BP.
XX
AC   NC_013926;
XX
PR   Project: 43333;
XX
DE   Aciduliprofundum boonei T469 chromosome, complete genome.
XX
OS   Aciduliprofundum boonei T469
OC   Archaea; Euryarchaeota; Aciduliprofundum.
XX
RN   [1]
RP   1-1486778
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Saunders,E., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Kyrpides,N., Mikhailova,N., Flores,G., Reysenbach,A.-L. and
RA   Woyke,T.;
RT   "Complete sequence of Aciduliprofundum boonei T469";
RL   Unpublished
XX
RN   [2]
RP   1-1486778
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (24-FEB-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1486778
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Saunders,E., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Kyrpides,N., Mikhailova,N., Flores,G., Reysenbach,A.-L. and
RA   Woyke,T.;
RT   "Direct Submission";
RL   Submitted (17-FEB-2010) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B310, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001941.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086508
CC   Source DNA available from Anna-Louise Reysenbach
CC   (reysenbach@pdx.edu)
CC   Organism available from DSMZ: DSM 19572
CC   Contacts: Anna-Louise Reysenbach (reysenbach@pdx.edu)
CC   Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1486778
FT                   /strain="T469"
FT                   /mol_type="genomic DNA"
FT                   /organism="Aciduliprofundum boonei T469"
FT                   /db_xref="taxon:439481"
FT   gene            53..1300
FT                   /db_xref="GeneID:8828504"
FT                   /locus_tag="Aboo_0001"
FT   CDS_pept        53..1300
FT                   /locus_tag="Aboo_0001"
FT                   /gene_family="HOG000230140" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02928"
FT                   /codon_start="1"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: CDC6 domain protein; AAA ATPase central
FT                   domain protein; KEGG: tga:TGAM_0128 cell division control
FT                   protein 6-like protein (cdc6); SMART: AAA ATPase"
FT                   /db_xref="GI:289595679"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="GeneID:8828504"
FT                   /translation="MGQVNLFEKHMRKLSLFKGNREALYPDYLPDSLPHREKEIDRLAE
FT                   ILVTALEGNKPSNVLIFGKTGTGKTAVVRYVGRELKRAEKVYAKKKIEYIYLNCETVDT
FT                   PYSILQNLGNYFIEDWDEKIPFTGWPMDKVFSTVKERIDEWNGIVVLVLDEIDKLVAKS
FT                   GDDILYQLLLLDSEMKNSRLSVIGISNELKFTDLLDPRVKSRLGQEKLIFSPYNAFQLQ
FT                   DILSERVKIAVKDDAVSDEVISICAAIAAQEHGDARRAIDLLRISIEIAEREGAEKVTD
FT                   RHVYLAKNKIEMDCITEAIKTLPLHSKIVLLGIALNEEAGNNTLTTGELYHIYSTLSKR
FT                   IGASPLTQRRVSDLISDMDMLGLISTKVKSFGRYGRTKIIELALPVQEVKKIIFEDEFL
FT                   AELNEVKLASQKKLFF"
FT                   /protein_id="YP_003482375.1"
FT   misc_feature    98..1198
FT                   /note="orc1/cdc6 family replication initiation protein;
FT                   Region: TIGR02928"
FT                   /db_xref="CDD:163076"
FT                   /locus_tag="Aboo_0001"
FT   misc_feature    164..688
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aboo_0001"
FT   misc_feature    239..262
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aboo_0001"
FT   misc_feature    order(242..265,512..514,620..622)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aboo_0001"
FT   misc_feature    500..517
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aboo_0001"
FT   misc_feature    665..667
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Aboo_0001"
FT   misc_feature    992..1231
FT                   /note="Winged-helix domain of essential DNA replication
FT                   protein Cell division control protein (Cdc6), which
FT                   mediates DNA binding; Region: Cdc6_C; cl08520"
FT                   /db_xref="CDD:176605"
FT                   /locus_tag="Aboo_0001"
FT   gene            complement(1289..2116)
FT                   /db_xref="GeneID:8826935"
FT                   /locus_tag="Aboo_0002"
FT   CDS_pept        complement(1289..2116)
FT                   /locus_tag="Aboo_0002"
FT                   /gene_family="HOG000142540" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:TVN0221"
FT                   /codon_start="1"
FT                   /product="signal peptidase I"
FT                   /transl_table="11"
FT                   /note="KEGG: tvo:TVN0221 signal peptidase I"
FT                   /db_xref="GI:289595680"
FT                   /db_xref="GeneID:8826935"
FT                   /translation="MEENNKGNLWRDTFKDVVISIIIVLVIFLSLYAYAQTWPPIVVIE
FT                   SGSMQHGDLSHIGTIDTGDIVIVKKVYSADDVVSYVEGRMKGYETYGDYGDVIIYKCHG
FT                   ELIIHRAIVYLHWNGKEWKIRGFENGNYPSWLHVTKDYITIDNVGYEHKKIIINLQKLN
FT                   PNVVGKEGFITMGDHNLARFGPSAYDQSTSGFIPICPYLVNYNMIVGVARGEIPWFGAI
FT                   KLYLTHTNTEEIPSNTNVNLAISLIVLVAGSVGIDYAIAHREEIKRKLRRLKE"
FT                   /protein_id="YP_003482376.1"
FT   sig_peptide     complement(2009..2116)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.785 at
FT                   residue 36"
FT                   /locus_tag="Aboo_0002"
FT   misc_feature    complement(<1772..1999)
FT                   /note="The S26 Type I signal peptidase (SPase; LepB; leader
FT                   peptidase B; leader peptidase I; EC 3.4.21.89) family
FT                   members are essential membrane-bound serine proteases that
FT                   function to cleave the amino-terminal signal peptide
FT                   extension from proteins that are...; Region: S26_SPase_I;
FT                   cd06530"
FT                   /db_xref="CDD:119398"
FT                   /locus_tag="Aboo_0002"
FT   misc_feature    complement(order(1790..1792,1973..1975))
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119398"
FT                   /locus_tag="Aboo_0002"
FT   gene            2204..2599
FT                   /db_xref="GeneID:8826936"
FT                   /locus_tag="Aboo_0003"
FT   CDS_pept        2204..2599
FT                   /locus_tag="Aboo_0003"
FT                   /gene_family="HOG000106269" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00037"
FT                   /codon_start="1"
FT                   /product="translation initiation factor eIF-5A"
FT                   /transl_table="11"
FT                   /note="KEGG: tvo:TVN0537 translation initiation factor
FT                   IF-5A; TIGRFAM: translation initiation factor eIF-5A; PFAM:
FT                   Translation elongation factor, IF5A-like"
FT                   /db_xref="GI:289595681"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="GeneID:8826936"
FT                   /translation="MSWRDVEVRELKVGGYMVVDDEPCKIVEMTTSKPGKHGEAKARIV
FT                   AIGVFDGQKRSLVYPVKHKVKVPIIEKRDAQVLAVMGDEVQLMDSETFETFELPIPEEL
FT                   KDQISPGKNVQYWEALGKRKIMKVMGE"
FT                   /protein_id="YP_003482377.1"
FT   misc_feature    2204..2587
FT                   /note="translation initiation factor IF-5A; Provisional;
FT                   Region: PRK03999"
FT                   /db_xref="CDD:167666"
FT                   /locus_tag="Aboo_0003"
FT   misc_feature    2411..2581
FT                   /note="S1_aIF5A: Archaeal translation Initiation Factor 5A
FT                   (aIF5A), S1-like RNA-binding domain. aIF5A is a homolog of
FT                   eukaryotic eIF5A. IF5A is the only protein known to have
FT                   the unusual amino acid hypusine. Hypusine is a
FT                   post-translationally modified lysine...; Region: S1_aIF5A;
FT                   cd04467"
FT                   /db_xref="CDD:88432"
FT                   /locus_tag="Aboo_0003"
FT   misc_feature    order(2417..2419,2483..2485,2552..2554,2567..2572)
FT                   /note="RNA binding site; other site"
FT                   /db_xref="CDD:88432"
FT                   /locus_tag="Aboo_0003"
FT   gene            2602..3474
FT                   /db_xref="GeneID:8826937"
FT                   /locus_tag="Aboo_0004"
FT   CDS_pept        2602..3474
FT                   /locus_tag="Aboo_0004"
FT                   /gene_family="HOG000204321" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01230"
FT                   /codon_start="1"
FT                   /product="agmatinase"
FT                   /transl_table="11"
FT                   /note="KEGG: tvo:TVN0538 agmatinase; TIGRFAM: agmatinase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="GI:289595682"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="GeneID:8826937"
FT                   /translation="MLLHFADANKNFNESFFIIFGVPFDGTSSYRHGSKFAPDEIRKAS
FT                   YNLESYVMEHKISLSELPIHDMGDIGTLDEFGNVEDVIDTVYSTMQSILPNKFPIMIGG
FT                   EHSITIGAAKALKKLNAGIIFIDAHGDFRDEYLGNKYSHACTARRAYDILNGKIISIGV
FT                   RSASQEEVEDAKDLNYEWIDSYEFQRLGWKRTIKKAMEILDVQKVYLSIDIDGIDPAYA
FT                   PGTGTPEFFGLSPMDVKNIINFLAPNLIGADITEVCPPYDNGNTSILAARLVQEIIAAK
FT                   WNTMEDKFK"
FT                   /protein_id="YP_003482378.1"
FT   misc_feature    2650..3438
FT                   /note="Arginase family; Region: Arginase; cl00306"
FT                   /db_xref="CDD:174098"
FT                   /locus_tag="Aboo_0004"
FT   gene            3509..4411
FT                   /db_xref="GeneID:8826938"
FT                   /locus_tag="Aboo_0005"
FT   CDS_pept        3509..4411
FT                   /locus_tag="Aboo_0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mma:MM_1508 hypothetical protein"
FT                   /db_xref="GI:289595683"
FT                   /db_xref="GeneID:8826938"
FT                   /translation="MRRIRRKEEGIASTVGTIFALMIFTSLLSMFMVQVVPVQIKENEA
FT                   EHDMEVLSQLSQLRSVIDILTLTKNTNYTAYVPIKLGAPGVPVVASPTYGQLSVYPAGL
FT                   NSTYNMTVSFVDNYSNYVSLHSQGSIQFTAPNRYYVPETFSYENGAIIRYNFYAKNAIM
FT                   PIKPNMKFQNVSGHVNVSMTMENIYGPPVTVTGVETRSLGVTLQGVYTQTYFLGGKELN
FT                   LTINDTYYYGLMPLNFTKYWIQEISNMLNESGILYTDNPSSLQNPNYPYYTISGNKIQL
FT                   YNVWNVVVRMVYIEVEVSS"
FT                   /protein_id="YP_003482379.1"
FT   gene            4411..6048
FT                   /db_xref="GeneID:8826939"
FT                   /locus_tag="Aboo_0006"
FT   CDS_pept        4411..6048
FT                   /locus_tag="Aboo_0006"
FT                   /gene_family="HOG000119939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   mbu:Mbur_0254 type II secretion system protein E"
FT                   /db_xref="GI:289595684"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:8826939"
FT                   /translation="MMPKGIKKLNFSIFQGIVKPQVKIKIPKFEVGRSSDITPIPPLEK
FT                   ENYETVEVYPVYPPYVYTRIIYDREEYEYIYDLIEPPLTDEEQRLLDEINDTLDRTLKY
FT                   EWEIMTNKDREQYLRESVDSFLRSRDIKIDKISKERILYYVVRDHVGYQKIEGLIRDEY
FT                   IEDISCDGVGVPIYVFHKKYQSIKTKLVYKDDDELNSFIVYISQKCGKQISVAEPILDG
FT                   TTAEGHRVQATYGREVTTRGGTFTIRRFKEKPFTPTELVLFGTASPEIVAYLWLMVEHG
FT                   ESAIVIGGPACGKTSTLNAFSMFIPPTAKIVSIEDTREINLPHQNWIPGTTRSGIGEAS
FT                   ITGKSAGEIDMYDLVRAALRQRPNYIIVGEVRGKETYTMFQAMATGHTTYSTMHADSIV
FT                   SMIHRLENPPINCPRILMTALNNVIIQKIVRTKEGITRRITQLVENVGFEPETNELITN
FT                   VVFEWDQARDTHKFKGHSYLFDKIMTMKNMTHNEMMEEFERRVDIVKYWVKKEILDFRD
FT                   IWKTIANYYKDPIGTAEEARLKLGEVKS"
FT                   /protein_id="YP_003482380.1"
FT   misc_feature    4822..5787
FT                   /note="Type IV secretory pathway, VirB11 components, and
FT                   related ATPases involved in archaeal flagella biosynthesis
FT                   [Cell motility and secretion / Intracellular trafficking
FT                   and secretion]; Region: VirB11; COG0630"
FT                   /db_xref="CDD:30975"
FT                   /locus_tag="Aboo_0006"
FT   misc_feature    5179..5733
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0006"
FT   misc_feature    order(5188..5190,5281..5298,5710..5712)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0006"
FT   misc_feature    order(5272..5277,5287..5295)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0006"
FT   misc_feature    order(5278..5283,5338..5340,5362..5364,5383..5394,
FT                   5398..5403,5488..5496,5500..5502,5539..5541,5551..5553,
FT                   5560..5565,5590..5598,5608..5610,5617..5619,5695..5697)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0006"
FT   misc_feature    5503..5520
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0006"
FT   gene            6045..7043
FT                   /db_xref="GeneID:8826940"
FT                   /locus_tag="Aboo_0007"
FT   CDS_pept        6045..7043
FT                   /locus_tag="Aboo_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /codon_start="1"
FT                   /product="Type II secretion system F domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   mhu:Mhun_3169 type II secretion system protein"
FT                   /db_xref="GI:289595685"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="GeneID:8826940"
FT                   /translation="MKLFAKLFAKYAPTPPNRPYKVKLPKGSLPTYINLDPYHKLAWKL
FT                   MGKMAEKSVKKKKFSKLEMDLLKAHILLRPQEYLAYVYFTTLLVGVIGIVMAAMLVLMG
FT                   LSLGNKMITILFLLIGIFMMVIIPIMTYFSLISSPASKAKKRAKDIDTHLPTAVNFIAA
FT                   LSSADVTVASIFKELSTRKEYGEIAKEAEWITRDTELLGKDILTAIEEASRRSPSVKWQ
FT                   EFLQGVITTATSGGRLKPFFMSKSEEYEKEKRLMLKKNMESLGLFAEIYVTVGVAFPLF
FT                   LVVIIAIMALINKNSAASTVMLLEIIVVVMIPVLIFVFSYFIYSTSKEVAE"
FT                   /protein_id="YP_003482381.1"
FT   misc_feature    6525..6902
FT                   /note="Bacterial type II secretion system protein F domain;
FT                   Region: GSPII_F; cl00906"
FT                   /db_xref="CDD:154078"
FT                   /locus_tag="Aboo_0007"
FT   gene            7040..7912
FT                   /db_xref="GeneID:8826941"
FT                   /locus_tag="Aboo_0008"
FT   CDS_pept        7040..7912
FT                   /locus_tag="Aboo_0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /codon_start="1"
FT                   /product="Type II secretion system F domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   mbu:Mbur_0449 type II secretion system protein"
FT                   /db_xref="GI:289595686"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="GeneID:8826941"
FT                   /translation="MNKEKLIFYVSAFIAAIFISIGIMLYLKKTNIFGLIPLDFIVIGT
FT                   SAFLFGPGIYDMLHTRKIKKMEERFPDFLRDVAESSRFGMTLADSIVVASSGKYGALTD
FT                   EIKRMASKISWGVPVKDALLSFNERVKTPLIDRITAIIIKSNEAGGNIADVLSMVARNA
FT                   RESQLAAKERNIEMFTYGFVLLTSFFVFLATIIILNNSFLPEMGKAGMAVEESFKKASV
FT                   AGALPGGGIAYEYVPIITLLFVIATIIHGVGDGIMIGILSDGRVKSGFVWAFVLLASGY
FT                   FILRLLGAV"
FT                   /protein_id="YP_003482382.1"
FT   misc_feature    7256..7633
FT                   /note="Bacterial type II secretion system protein F domain;
FT                   Region: GSPII_F; cl00906"
FT                   /db_xref="CDD:154078"
FT                   /locus_tag="Aboo_0008"
FT   gene            7923..9566
FT                   /db_xref="GeneID:8826942"
FT                   /locus_tag="Aboo_0009"
FT   CDS_pept        7923..9566
FT                   /locus_tag="Aboo_0009"
FT                   /gene_family="HOG000119939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   mbu:Mbur_0254 type II secretion system protein E"
FT                   /db_xref="GI:289595687"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:8826942"
FT                   /translation="MAISKKEIPTKLKIVNMMRPIIKSEKLKVKTPKKHTAHGSNITPL
FT                   PEIKSPSIKEIEVDPIEEPYSYVRILFDEVTSEYIYEVIEPPITDDEKKILENIKSKLI
FT                   EVLELKDFENDEERKEYLMEKTEEIIEEMNTPVDSVVLDRLKYYVYRDFLGYGLVQVPM
FT                   HDSEVEDISCDGVNIPIYIYHRMYGSIRSNLKFQKEDELDNYVIWIVQKSGRHISISNP
FT                   MVDASLPDGSRLQATLGKHVTKRGSSFTIRRFKPNPFTPIDLIRFKTMSREMMAYIWLA
FT                   VENGMSIIVCGGTASGKTTTLNAILLFIPPNMKIASIEDTRELNLPHENWIPSLTREGL
FT                   GEPNPVTGKRPGEIDMFDLLKAALRQRPQYIMVGEVRGPEAYTVFQAMATGKTCYTTFH
FT                   ADDVKSMVHRFENAPINLPRALITALDIVILQAQVKVGTAMTRRVKSITEIVGLDPETN
FT                   EIITNNAYTWNPADDTFNYSGHSYIYEKISAIKGWSQRRMELEVKRRERILEYMEKLGV
FT                   RYYRDVARIVAAYYKKPEEVLKRVEEVLSS"
FT                   /protein_id="YP_003482383.1"
FT   misc_feature    8349..9314
FT                   /note="Type IV secretory pathway, VirB11 components, and
FT                   related ATPases involved in archaeal flagella biosynthesis
FT                   [Cell motility and secretion / Intracellular trafficking
FT                   and secretion]; Region: VirB11; COG0630"
FT                   /db_xref="CDD:30975"
FT                   /locus_tag="Aboo_0009"
FT   misc_feature    8703..9260
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0009"
FT   misc_feature    order(8712..8714,8805..8822,9237..9239)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0009"
FT   misc_feature    order(8796..8801,8811..8819)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0009"
FT   misc_feature    order(8802..8807,8862..8864,8886..8888,8907..8918,
FT                   8922..8927,9015..9023,9027..9029,9066..9068,9078..9080,
FT                   9087..9092,9117..9125,9135..9137,9144..9146,9219..9221)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0009"
FT   misc_feature    9030..9047
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Aboo_0009"
FT   gene            complement(9568..14079)
FT                   /db_xref="GeneID:8826943"
FT                   /locus_tag="Aboo_0010"
FT   CDS_pept        complement(9568..14079)
FT                   /locus_tag="Aboo_0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tvo:TVN1212 hypothetical protein"
FT                   /db_xref="GI:289595688"
FT                   /db_xref="InterPro:IPR002345"
FT                   /db_xref="GeneID:8826943"
FT                   /translation="MKKSVVLMSILIILMMILGGFGYLVANSNAYGANSKSSVVGEGNI
FT                   NNMATSPTGSTTGNTVYITNTFVINRTTVGGGGRYGFDANVVVTPTGKLIVENVTLYFL
FT                   SDIDHRYSLTVEGGLYFYNVTFTISHGLIKPYYPFNFIIKGPSTAKVEIINSRLLYPGW
FT                   FNVTDKHGNVIIENTIFGKMVKNPADYPAPPNYGPTPYFYNSLAYIMNTRFTNMFTNES
FT                   GGNGLVGYVNDTYRYTVTVSSGVTFNHFLKSPIDKYSDYWNYVMLKDIEVGIVYSNTSD
FT                   YDPSSSNFIMVYNGTQLLNISFPGTKGTGMIKENVPFYPYEMTPNQFYQKLLNGDIKLY
FT                   ATNTTNGTLTISKVYINIYIEANLLKYGVNKFSFNSIGSTLYMRDVYVDVNYQSRENLG
FT                   TTHNTFFVNDNSKIYALNLTVNDTGTQPRYDTAFLIRDSYSQVYILRYTHVNVQFRGIP
FT                   INGLTVKAKPNPVDVNSNPSIASQILGIISSYVQYTRLIPGMKLGDVQISNGYVYDTTV
FT                   NGNVTLPLLSDIINASEMPNSKYLGIYALSVENSTKVFSTLQIGLSYYPWLLPSNNTLN
FT                   VNVALSRYKDIDMHINYEEVVSAQPYVPGKEIVIKTQVENLGKDLANDVKLYVYINGNL
FT                   YNVYDLGNINGKGKKDFTYKIGGSWLGTNGVYNISEQVVQVWDYNLANNRIYRDINVGS
FT                   IGTSNWQVGTPLRYHKIWVNLTVYSVYSWNNIKINLYLDNTSNIINSTILDLKEGYNYI
FT                   SFQWYINKNISVGSHTLLLYIANNNLYLGSHYVNVEKDVNLAVNSLNISPQSLYVGETV
FT                   KIAANVINLGKEEPTSAMVYINVYDPYGTLLINKTIQYSTSISAYSISMVPDTDGSYEV
FT                   IVKVVASGDYNSSNNIMSEYFMVYAEPFSVQINAQNEYVNGTNIIVNATLNSNVDANVT
FT                   MVLYIPQWNIELAPITPHNPIKVEINTPIVIGFVIPKSLYQKYLQGRTSIQIDYQLNIT
FT                   SDVTEDALYIHTAPTITIKEKVNFVLTDFTISEGNKKVSSVPEGVKIKIGFIARNLGGM
FT                   PGKLNYIVLDNGKVIYKGNVSSLAPGSYKAIIFNYTSNGIGEHNIVVKLNPNKTVEESI
FT                   YGDDIGVKKINVLLPAMKVMFTSYSLEHNEKIYAGDTLVVVVKIINLNATQSQGKTVYM
FT                   KGVTVQLTLTGGLGTYTQKTNAYGLAIFHIKVPAKGTYTPQLTLSYEGTETRYNPQTTI
FT                   TVQEKPYTIPWLWIIIIVVVGAIVGFFLYGYISFKKEAPEYMVCGNCGHLVPADAEKCP
FT                   YCGVVFEKEKVKCPTCGSWIDEDSKFCPVCGTIFMPPEDPEYKKYEKLKENYDRYLSKY
FT                   RDEAKKYIGEEYTEEEFYKWWKTNPEFISFLEWVKRQEEKIEGDTVKCPVCGALNPKGA
FT                   KICRVCGSPLPTGEEKKEKKEEGEGKKEQKESKESSIPPEELERLQRPGVVTVEEWAKR
FT                   KEKEEKKEGKVSEKKEEKKEEKPVIKKKLIKKVIAVKKEEKK"
FT                   /protein_id="YP_003482384.1"
FT   misc_feature    complement(10204..10275)
FT                   /note="Uncharacterized protein family UPF0547; Region:
FT                   UPF0547; pfam10571"
FT                   /db_xref="CDD:151108"
FT                   /locus_tag="Aboo_0010"
FT   gene            14365..17290
FT                   /db_xref="GeneID:8826944"
FT                   /locus_tag="Aboo_R0001"
FT   rRNA            14365..17290
FT                   /db_xref="GeneID:8826944"
FT                   /locus_tag="Aboo_R0001"
FT                   /product="23S ribosomal RNA"
FT   gene            17322..18362
FT                   /db_xref="GeneID:8826945"
FT                   /locus_tag="Aboo_0011"
FT   CDS_pept        17322..18362
FT                   /locus_tag="Aboo_0011"
FT                   /gene_family="HOG000222903" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /codon_start="1"
FT                   /product="protein of unknown function Met10"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function Met10; KEGG:
FT                   mfe:Mefer_1490 protein of unknown function Met10"
FT                   /db_xref="GI:289595689"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="GeneID:8826945"
FT                   /translation="MIGHSKIFYLAFHSSFVPYVIKVKKENAEKMRKWLFKKKILSDEW
FT                   KIVQEGDYIYFPLREKIDGSVWIDLPKRDRKKSPYERIVNKIGKEIEIPNHWEKIGDTV
FT                   ILQEFKDWKKYGYEVGKAFAEVLKAKTVVIYHGTYGEFREPRITKIFGESTETIHIENG
FT                   IKYKLDIAKIMFSSGNVDERIRMGKIDARDEIIVDLFAGIGYFTLPLAKSGRAKKIYAC
FT                   EKNPIAYRYLLENIELNQLENIIPLFGDNRNISPLKIADRVIMGYIHTEPFLGIGFKAL
FT                   KKEGGIIHYHNTITTEERDWKMENELKFYGEKYGFKISIISKRVVKSYAPHIWHVVIDA
FT                   RATPKN"
FT                   /protein_id="YP_003482385.1"
FT   misc_feature    17370..18344
FT                   /note="Predicted methyltransferase [General function
FT                   prediction only]; Region: COG2520"
FT                   /db_xref="CDD:32590"
FT                   /locus_tag="Aboo_0011"
FT   misc_feature    17610..18191
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Aboo_0011"
FT   gene            18387..19109
FT                   /db_xref="GeneID:8826946"
FT                   /locus_tag="Aboo_0012"
FT   CDS_pept        18387..19109
FT                   /locus_tag="Aboo_0012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mbu:Mbur_2059 hypothetical protein"
FT                   /db_xref="GI:289595690"
FT                   /db_xref="GeneID:8826946"
FT                   /translation="MADIPFYIATIVGFVPSFALLYIYWGKLEGLFHEKKMFWNYFIGW
FT                   IMGVIIAIFFLISKYSVGGYLDLSIIFVIFFALFTESFKFIYLNFPKKRGNYELPYFGF
FT                   ALGLGISAIWAVAIVYQYLKYEQLNEINYVIAIVSLFLFSMGLSAIHASTGAIIGYGIY
FT                   KGEKERFLLKAFALQIIFNFTLLPLIWNLYPLYYFFGIFIGMPYLYSKVYKGVLINVIP
FT                   KEVKRKWLKERRERGERL"
FT                   /protein_id="YP_003482386.1"
FT   gene            19070..20200
FT                   /db_xref="GeneID:8826947"
FT                   /locus_tag="Aboo_0013"
FT   CDS_pept        19070..20200
FT                   /locus_tag="Aboo_0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /codon_start="1"
FT                   /product="transglutaminase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ckr:CKR_2935 hypothetical protein"
FT                   /db_xref="GI:289595691"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="GeneID:8826947"
FT                   /translation="MAKGKERKRGKIVGKAIAISVFLLLLYIMMPTINGLVKNPPSFES
FT                   YAIPKEMTFKFERIITINAVGNYTLNLTIPQNNQFQNVSVEDLSNLKKRVVNEYNRTVW
FT                   SYPLKNDSKIKLVYQGKVLAKVWNIKDSLDVNAIPQSLKRQYNHNESLIYYDEKEHTYV
FT                   REIVIDPYEFRDVAKKLTQNDTNVLEKLRTIYNVIVDNFHYVSERKGLPSSAVETWNRG
FT                   DGDCDELSFVFVSMARSLGIPAWVEYGLVYTQGTWSPHAWIGTVVPTKNGLVKVNIDTT
FT                   VEVGRENLGLGFLIRNADRIEEWQDDGNSTHLNSYYTFIRGYYENLHYTEQVNVFYSNQ
FT                   TGKITIPIEGTQFPSWLIMTILAIIIIAVFIIIIRF"
FT                   /protein_id="YP_003482387.1"
FT   misc_feature    19589..19855
FT                   /note="Transglutaminase-like superfamily; Region:
FT                   Transglut_core; cl10469"
FT                   /db_xref="CDD:176834"
FT                   /locus_tag="Aboo_0013"
FT   gene            complement(20197..21168)
FT                   /db_xref="GeneID:8826948"
FT                   /locus_tag="Aboo_0014"
FT   CDS_pept        complement(20197..21168)
FT                   /locus_tag="Aboo_0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mba:Mbar_A3652 hypothetical protein"
FT                   /db_xref="GI:289595692"
FT                   /db_xref="GeneID:8826948"
FT                   /translation="MVVDLRELLKKIFALKGIEVLDREPYDYIWVRHEEGLELIYLEEN
FT                   EDVDGDYVLSFARNTEQVHASKTIICIKECTQDARKMAEKLGIELLNRAEFARVLGELI
FT                   IELYESNKLEELNILEEEDVEVEDFEELESEDEDVIPIFLEEVGDGEERIIKPAISPQE
FT                   ADRIAREYVHGFTQELVLLPYYVFDYSLEVLIEGTIQTKAVKGVLALNALNGKGEFWKR
FT                   GYETVTRLDIEHRKMEPKIDFEEAKMIAEKSLEEEYSKEEEVKIEGENVTIIEKRKTRP
FT                   KKGSVKTNFLGLYYLPVWIMSGKGGMIMINAVTGATMKGKIY"
FT                   /protein_id="YP_003482388.1"
FT   gene            complement(21173..21379)
FT                   /db_xref="GeneID:8826949"
FT                   /locus_tag="Aboo_0015"
FT   CDS_pept        complement(21173..21379)
FT                   /locus_tag="Aboo_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PH0065.1n"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pho:PH0065.1n hypothetical protein"
FT                   /db_xref="GI:289595693"
FT                   /db_xref="GeneID:8826949"
FT                   /translation="MLEEAFENVVPYISNLRELKEFVEENKNKSENEILSILKEKVESS
FT                   QGTLKTDFRILLNEFGKIINKRM"
FT                   /protein_id="YP_003482389.1"
FT   gene            complement(21414..21818)
FT                   /db_xref="GeneID:8826950"
FT                   /locus_tag="Aboo_0016"
FT   CDS_pept        complement(21414..21818)
FT                   /locus_tag="Aboo_0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ton:TON_1123 hypothetical membrane protein"
FT                   /db_xref="GI:289595694"
FT                   /db_xref="GeneID:8826950"
FT                   /translation="MPVIGESSKVKSMLELLNIAKILALVMGILGFLLAAGAAWPLVYG
FT                   AWSSLFGAIYWIIAAIINLMAYMRMDEFVGMVKERRYSEFYDILITWMVLTLVFGVIVG
FT                   VLLLIVFIEVNELKTSSEFSTPPQAPPPPQ"
FT                   /protein_id="YP_003482390.1"
FT   sig_peptide     complement(21702..21818)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.772 at
FT                   residue 39"
FT                   /locus_tag="Aboo_0016"
FT   gene            complement(21865..22464)
FT                   /db_xref="GeneID:8826951"
FT                   /locus_tag="Aboo_0017"
FT   CDS_pept        complement(21865..22464)
FT                   /locus_tag="Aboo_0017"
FT                   /gene_family="HOG000231212" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mthe_1698"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mtp:Mthe_1698 hypothetical protein"
FT                   /db_xref="GI:289595695"
FT                   /db_xref="InterPro:IPR012041"
FT                   /db_xref="GeneID:8826951"
FT                   /translation="MERIYRIMKLLCPNCNREVEQKVLSVKYRKNGTEYTLKCTNCGYT
FT                   YKKFFEDEKMVDVKVIWSWRDKSEVKRISKLEEDIITVGDEVKVDGINSQITAIESDGK
FT                   RVKSAKVKDIDTLWAKRFDKVVVKISVNRGSKTVSYEIIAHPDEEFYVGDIIDVEKMHA
FT                   VIHKIKTKERFVMRGGALARDIVRIYAKEIREVREY"
FT                   /protein_id="YP_003482391.1"
FT   misc_feature    complement(21868..22449)
FT                   /note="Uncharacterized archaeal Zn-finger protein [General
FT                   function prediction only]; Region: COG1326"
FT                   /db_xref="CDD:31517"
FT                   /locus_tag="Aboo_0017"
FT   gene            22553..26254
FT                   /db_xref="GeneID:8826952"
FT                   /locus_tag="Aboo_0018"
FT   CDS_pept        22553..26254
FT                   /locus_tag="Aboo_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: syn:slr0408 integrin alpha subunit protein"
FT                   /db_xref="GI:289595696"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="GeneID:8826952"
FT                   /translation="MLRDALEKYGLNRDDIDALVANFKSVEDIINAEPSQISSISSLNT
FT                   DEVKNLQKFLKGLNSKNGVGHDFLKRWGKVTSEEDLKAAYEEYTRLSKLYPNSPVVWEI
FT                   RGDILEKMGSFKDARKSYEKAYMLYLKKGEEPPVKLKKKFGSQPTITPKKVGLSNGFGN
FT                   INGFKNGFKNGIVNGTGIVNGTGGGRKAPQQKGWKVLISVLIVFLIISAPLVGMIFFEK
FT                   HYVYAVDGNFQEWVENIPYYGLKSEDKSINVNFVKFHISTGGIYFYLDANKNLFTNASG
FT                   IYIFLDTDNNSHTGYLVEGIGADYMVELYGWNRTLQGKELYKFNGTNQLDFNNFTYIGG
FT                   IKAIDRNGQIEGFINLQVSGFRSFVISSDYKGIQAIVPCMDYGKHTFIAEESTLTNLIP
FT                   LYQNTPLLKINIIGKNIRIHRIVLEDMGNAELSAIKSIELYEGNKNDSFGSWDKYVASA
FT                   NIKGKNVEFNNLNLDLSSNSTLFITVKIENASLSTKTFMLKINTIEANMPYYIDNDISG
FT                   GAYINKIPSHPVIDGAFADWKNYLRNDSSNDVIAPNGKIVNGYPNIDLLQYGAYNAQYL
FT                   YMFLKVRGKILGGADVPKIEVFHLPDSDGDTVPDKYDPYPHDFNNDGIPDNESYVIVNG
FT                   TKLPDVDGDGIPDYPYGPDMWLNTTIPSWFPKPYAGRQVHRYIGPVPHKVIKGMDTIEI
FT                   YINSDNNTHTGYSLPKYPIGADYKIEMFGKDGIVYNASLYNYSNGKWIFVKHISPKLGY
FT                   HAMELNTGVETKNSKEYIFIFDWRNDKDVADVPLEQSKQSKNTLKVHKISFHTNLTTKT
FT                   FTASSIRSIKPKSLGTLTASQLSFGKDVKLQVKNSNRRYEERPSITITSNGTLWTVWSF
FT                   ERKNGAHDIALAYSTDDGATWAGERLNASRNYDDANPIIISDSEDNLYIFFENHTKQGA
FT                   SFQILKLTPSSSTWKLYSYTNSSWWGNVYNLSAYSYSNYIYLAFEYHNSSSNSSLGYMY
FT                   TSNGGYSWHVIIFNNTYWTGHPSITISSGTNSRVFIAFDYYGDNGLFNEYQWYVSVINN
FT                   SYLGDNNWKLNEITQYEFDNCQYPSIADSGNTIYVVFQEEFSSEDYDIYITTSTNNGNS
FT                   WSSPWPVTLSSDDEEYPWVVAYGQNVYVFYLDNTTGYISIIESNDGGQSWSNPITVSDN
FT                   GTGISVYRTVSAMYAGGKLYVVWTDSRSGNGDIYFDKTEVPEFHDFAILIIPLLAIIVI
FT                   SRRRKNKQ"
FT                   /protein_id="YP_003482392.1"
FT   gene            complement(26271..26543)
FT                   /db_xref="GeneID:8826953"
FT                   /locus_tag="Aboo_0019"
FT   CDS_pept        complement(26271..26543)
FT                   /locus_tag="Aboo_0019"
FT                   /gene_family="HOG000105803" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00285"
FT                   /codon_start="1"
FT                   /product="DNA-binding protein Alba"
FT                   /transl_table="11"
FT                   /note="KEGG: tac:Ta0912 DNA/RNA-binding protein AlbA;
FT                   TIGRFAM: DNA-binding protein Alba; PFAM: Alba,
FT                   DNA/RNA-binding protein"
FT                   /db_xref="GI:289595697"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR013795"
FT                   /db_xref="GeneID:8826953"
FT                   /translation="MAEENVVFVGKKPTMNYVLAVVTQFNSGVNTVILKARGKAISKAV
FT                   DVAEIVRNRFVPSLQYGEIKIGTESLQSEKGETNVSSIEIEMKRE"
FT                   /protein_id="YP_003482393.1"
FT   misc_feature    complement(26277..26543)
FT                   /note="Alba; Region: Alba; cl00682"
FT                   /db_xref="CDD:174345"
FT                   /locus_tag="Aboo_0019"
FT   gene            complement(26625..30704)
FT                   /db_xref="GeneID:8826954"
FT                   /locus_tag="Aboo_0020"
FT   CDS_pept        complement(26625..30704)
FT                   /locus_tag="Aboo_0020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02460"
FT                   /codon_start="1"
FT                   /product="Patched family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Patched family protein; KEGG: hut:Huta_2918
FT                   exporter of the RND superfamily protein"
FT                   /db_xref="GI:289595698"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="GeneID:8826954"
FT                   /translation="MELRALGNLVSKRPVATIIVILLITSIFGFYTAQMQMSADLSTFL
FT                   PNDEMVKAQMKVSENFGDTDIVQVIVVSNNTLSKSSLMDMLTIEENLQNDSIISKNLRT
FT                   PNSPSESIISPADIIIMGNITLNFENKLTELLKNMSAEMKGLNFTVALIPMRMMNSVMS
FT                   DYRDIYENATDIRDDAKDIVLLMFSKPSSNETGMGKIEPLLQNLTYVLTQSNNFSVKSK
FT                   VLTMLTPPLGNSTLGNESMNPLFKYFVEDILSNMSLENKSISVHYFSLTNTFTESSLDY
FT                   SLSSINSAIDGNNQLINALNMVKGSIMSGDNATALYIMNKTIEGVSSNIAHMSFAYPYY
FT                   YSFNNSLSKFLYDFKMGTLTPQDVESLKENTSAMLTISSGEFKNMLQILYDTLNQWTQS
FT                   NYISYDLLYEANSTLPAVQGFLQNYQGAIMLNNSLTSIKMEINYAPVGNTTAHIEYLIG
FT                   YLKNANAELEKQKEFIENAMGAMDTPYYRWYTQMLSDLDYVLYNSNVADYAMNIFVFTL
FT                   QMMNEGAQGGNMGDFTIFYSLKHAFDSNVAPKYKEEIQSMYLTIMGMMKIGKGYEGEMP
FT                   SMPSSPSIKLPNLNPSYAEKKNILKNMSYEDITKTVSSIENYNASEFMNTVNSTIPIVE
FT                   NASANMSSFANDIEKLVNNMEFVYSTTGDYNVSNMLKMYTQLHANISAASNALDSLSSN
FT                   LPHMSGFTYMMHRFSGQLKTMFSKDFNGKTAKAAMLIVMLNDTRLPGESDAQHSKRMEA
FT                   LEERVESIAKESDISSKVMVMGTYLISQATEKTSNETMNVIFPIAIILVIVILLITFRS
FT                   IVDTLLGILGLGMAISWAYGFGVIMNYNFNQISTTVAVLLVGLGIDYAIHTILRYREEL
FT                   RKGRKVRDAMNEMITHLGMGLILATITTIIAFLSNVSSPIPPVSDFGIMNAVGIFGAFV
FT                   IFTTAIPAMKILIDERREKKGKLKIKKEKEREGSGLIVLNKFMALSAMAAEHHRIAVIA
FT                   AVLLISGVAIYGGMNVNTTFDLKDFLPQNLEITDTINFMMDHFNASGMSDNYVLIEGNI
FT                   TSPSALKAVQATMQNLKDDDYVDYSQSSSITTLISEWKEKNSTFAKMVSGNDTNGDGLP
FT                   DKNIKAIYDWLYENANGKSILHKSNGTYDSMLIIIRSSASNDKENKILTKEIDEDIQPL
FT                   KDAGLKAIPTGTNLLTFHILDMLEGSQWRSLMITVIASLIVLTIVFLYEKRSWILGLIT
FT                   SIPVVLALLWLLGSMYALGINFNVVTVTITSLTIGLGITYAIHITHRFLEDWEREKSIE
FT                   DAVKKTVRHTGTSIFGAAATTMAGFGTLMLSSMPPIQQFGEIAALSILYSFVLSVFILP
FT                   TFLYMWASWREKRNKL"
FT                   /protein_id="YP_003482394.1"
FT   misc_feature    complement(<30165..30698)
FT                   /note="Predicted exporters of the RND superfamily [General
FT                   function prediction only]; Region: COG1033"
FT                   /db_xref="CDD:31236"
FT                   /locus_tag="Aboo_0020"
FT   misc_feature    complement(26640..28487)
FT                   /note="Predicted exporters of the RND superfamily [General
FT                   function prediction only]; Region: COG1033"
FT                   /db_xref="CDD:31236"
FT                   /locus_tag="Aboo_0020"
FT   gene            30851..31888
FT                   /db_xref="GeneID:8826955"
FT                   /locus_tag="Aboo_0021"
FT   CDS_pept        30851..31888
FT                   /locus_tag="Aboo_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TrmB"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   tko:TK1259 Lrp/AsnC family transcriptional regulator"
FT                   /db_xref="GI:289595699"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8826955"
FT                   /translation="MKLNDVEKRIICALCKNPDMSARELAEFLDLNYWTVYKSINKMRG
FT                   KGIFKETIIPNFKALGFELLVIGYGSLTKKKMDVLQEVKTLKTNLKFSSGVFYSFAESY
FT                   RGFVLAVSKNYTEVVKGLIYAERLIRVREFLKGENTEMVILPFEITEIPLFFDYSNLIC
FT                   KEFKLDLEKRGERKERMKKLSMKNAKVMMEIVKNPEAKILHIAKRLNMAPQSVSKIKDR
FT                   LFAEGYVSKKIIPNLPLLGYDVLVFAHWNSNPEVMEKMQNIKIEALGYDMSNVIFTAYN
FT                   SLEGVAIAPFKSLKESRDIVSFFENFGEETGVLTKEPNILFLSLQEGVAMRDHEYYPIL
FT                   ASIFK"
FT                   /protein_id="YP_003482395.1"
FT   misc_feature    30857..>31051
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Aboo_0021"
FT   misc_feature    31427..31624
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Aboo_0021"
FT   gene            complement(31874..33016)
FT                   /db_xref="GeneID:8826956"
FT                   /locus_tag="Aboo_0022"
FT   CDS_pept        complement(31874..33016)
FT                   /locus_tag="Aboo_0022"
FT                   /gene_family="HOG000241404" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.32"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: pho:PH0722 amino acid
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="GI:289595700"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:8826956"
FT                   /translation="MELAEFKKYEDEVIRLRRDFHMHPELGFEENRTSGIVRDYLNDLG
FT                   IETRVMAKTGVVGEINNGGNKRIAIRADMDALPINEENDVPYRSIYPGKMHACGHDAHT
FT                   AMLLVTAKILSRMEFEGNIRFIFQPAEEGLNGARKMVEEGAIDGVDSIFGLHVWANLPS
FT                   GNIAISSGPVLANVDLFRVVIEGKGGHGASPHETMDPIVASSYIISSLQSIVSRNVDPM
FT                   KSAVITVGKINGGTAFNIIPEEVEFEGTVRTFDEDVHNLIENRIKELIDNEARAFGAKG
FT                   KIEYRHLNYATVNDERLAIIGRKVAVRIMNVVEQEPDMGGEDFSEYARIIPGLFAFLGT
FT                   RNEGKGIIYPHHNPRFNVDESALIYGVAFEVNMAIELLKN"
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_003482396.1"
FT   misc_feature    complement(31877..33016)
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]; Region: AbgB; COG1473"
FT                   /db_xref="CDD:31662"
FT                   /locus_tag="Aboo_0022"
FT   misc_feature    complement(31895..>32974)
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Aboo_0022"
FT   gene            33093..33674
FT                   /db_xref="GeneID:8826957"
FT                   /locus_tag="Aboo_0023"
FT   CDS_pept        33093..33674
FT                   /locus_tag="Aboo_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0266 hypothetical protein"
FT                   /db_xref="GI:289595701"
FT                   /db_xref="GeneID:8826957"
FT                   /translation="MGLLNELEEIKRKEKERKKELQKLKRNFYEDVIKKIDSFRVEARI
FT                   YVEKMDIERAGRIMDEIKKIEKSLDEIIALRVRKILLFTIWKDERDVKNLTKEEELLYR
FT                   EVKEAIERHKNMIYGREEIQQVERKIDKNVEEEKGEKIEEYVLARVKAPSLKIALPDRN
FT                   LILRKEDVLHMPKKIYEILLKSDYVEEIKL"
FT                   /protein_id="YP_003482397.1"
FT   gene            33725..34177
FT                   /db_xref="GeneID:8826958"
FT                   /locus_tag="Aboo_0024"
FT   CDS_pept        33725..34177
FT                   /locus_tag="Aboo_0024"
FT                   /gene_family="HOG000230649" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01090"
FT                   /codon_start="1"
FT                   /product="Ribosomal protein S19e"
FT                   /transl_table="11"
FT                   /note="PFAM: Ribosomal protein S19e; KEGG: afu:AF2069 30S
FT                   ribosomal protein S19e"
FT                   /db_xref="GI:289595702"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="GeneID:8826958"
FT                   /translation="MVTVYDVPPEKLIASVAEKLKEEKIEPPEWSRWVTTGVHKEKGPE
FT                   QEDWWYIRLASVLRKIYIMGPIGTSRLAAEYGGKEDRGSKRYKARKGSRAIVRKALQQL
FT                   ESLGYVKKDKKGRVITPKGRSFMDNVAHEIMKELVKESPELEKYTK"
FT                   /protein_id="YP_003482398.1"
FT   misc_feature    33725..34171
FT                   /note="Ribosomal protein S19e; Region: Ribosomal_S19e;
FT                   cl00969"
FT                   /db_xref="CDD:174485"
FT                   /locus_tag="Aboo_0024"
FT   gene            34184..34519
FT                   /db_xref="GeneID:8826959"
FT                   /locus_tag="Aboo_0025"
FT   CDS_pept        34184..34519
FT                   /locus_tag="Aboo_0025"
FT                   /gene_family="HOG000194121" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01984"
FT                   /codon_start="1"
FT                   /product="DNA-binding TFAR19-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: DNA-binding TFAR19-related protein; KEGG:
FT                   pto:PTO0204 hypothetical protein"
FT                   /db_xref="GI:289595703"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="GeneID:8826959"
FT                   /translation="MDDKELEEIKRRKMLELMQQQVLAQENNDEQKRLEEEAARQAILR
FT                   QILEPEARERLARLKLVRPELANAVENQLILLAQSGRIGRMITDEELKSILSRLTSQRR
FT                   EIRIERR"
FT                   /protein_id="YP_003482399.1"
FT   misc_feature    34196..34516
FT                   /note="Double-stranded DNA-binding domain; Region:
FT                   dsDNA_bind; cl00928"
FT                   /db_xref="CDD:174463"
FT                   /locus_tag="Aboo_0025"
FT   gene            34522..34677
FT                   /db_xref="GeneID:8826960"
FT                   /locus_tag="Aboo_0026"
FT   CDS_pept        34522..34677
FT                   /locus_tag="Aboo_0026"
FT                   /gene_family="HOG000230627" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00832"
FT                   /codon_start="1"
FT                   /product="Ribosomal protein L39e"
FT                   /transl_table="11"
FT                   /note="PFAM: Ribosomal protein L39e; KEGG: tvo:TVN0009 50S
FT                   ribosomal protein L39e"
FT                   /db_xref="GI:289595704"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="GeneID:8826960"
FT                   /translation="MARNKHVARKMRLIRKMNSNRRVPAWVMMRTDRKFTQHPHRRNWR
FT                   RNKLKV"
FT                   /protein_id="YP_003482400.1"
FT   misc_feature    34522..34674
FT                   /note="Ribosomal L39 protein; Region: Ribosomal_L39;
FT                   cl00952"
FT                   /db_xref="CDD:174476"
FT                   /locus_tag="Aboo_0026"
FT   gene            34689..34952
FT                   /db_xref="GeneID:8826961"
FT                   /locus_tag="Aboo_0027"
FT   CDS_pept        34689..34952
FT                   /locus_tag="Aboo_0027"
FT                   /gene_family="HOG000230616" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01198"
FT                   /codon_start="1"
FT                   /product="Ribosomal protein L31e"
FT                   /transl_table="11"
FT                   /note="PFAM: Ribosomal protein L31e; KEGG: tvo:TVN0010 50S
FT                   ribosomal protein L31e"
FT                   /db_xref="GI:289595705"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="GeneID:8826961"
FT                   /translation="MAEKEMIFNVPLRKAKMVPRTRRANYAIKLLRAYISRHMKVPIEN
FT                   VWIDNQVNEAIWKRGIQKPPSKITVKAIKFEEEDTVEVLMPE"
FT                   /protein_id="YP_003482401.1"
FT   misc_feature    34695..34949
FT                   /note="Ribosomal protein L31e; Region: Ribosomal_L31e;
FT                   cl00921"
FT                   /db_xref="CDD:174460"
FT                   /locus_tag="Aboo_0027"
FT   gene            34949..35605
FT                   /db_xref="GeneID:8826962"
FT                   /locus_tag="Aboo_0028"
FT   CDS_pept        34949..35605
FT                   /locus_tag="Aboo_0028"
FT                   /gene_family="HOG000230604" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00323"
FT                   /codon_start="1"
FT                   /product="translation initiation factor eIF-6"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: translation initiation factor eIF-6; PFAM:
FT                   translation initiation factor IF6; KEGG: pto:PTO0207
FT                   translation initiation factor IF-6; SMART: translation
FT                   initiation factor IF6"
FT                   /db_xref="GI:289595706"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="GeneID:8826962"
FT                   /translation="MIKKISINGSPFVGVYASCNNSIAVLPNIEINEDIFKKTLNVETF
FT                   KTTLGGSPLIGSLMVMNSKGAVVTNFASDEDVSFLFDRINVFFVEDKINAIGNDILAND
FT                   KAALVHVDFDKETIKYIEDALDVEVVKGEIGGIKTVGSAAVVTNKGMLVHPNVKDEEIE
FT                   FLKNLFGVPVYISTANYGSLYVGASIVANDYGAIVGDKTSNVEVDRIENALDIIE"
FT                   /protein_id="YP_003482402.1"
FT   misc_feature    34958..35593
FT                   /note="Ribosome anti-association factor IF6 binds the large
FT                   ribosomal subunit and prevents the two subunits from
FT                   associating during translation initiation. IF6 comprises a
FT                   family of translation factors that includes both eukaryotic
FT                   (eIF6) and archeal (aIF6)...; Region: IF6; cd00527"
FT                   /db_xref="CDD:29623"
FT                   /locus_tag="Aboo_0028"
FT   misc_feature    order(34958..34960,35531..35545)
FT                   /note="'Velcro' closure; other site"
FT                   /db_xref="CDD:29623"
FT                   /locus_tag="Aboo_0028"
FT   gene            complement(35595..36230)
FT                   /db_xref="GeneID:8826963"
FT                   /locus_tag="Aboo_0029"
FT   CDS_pept        complement(35595..36230)
FT                   /locus_tag="Aboo_0029"
FT                   /gene_family="HOG000223953" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Teth514_0613"
FT                   /codon_start="1"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tex:Teth514_0613 Zn-dependent hydrolase of the
FT                   beta-lactamase fold-like protein"
FT                   /db_xref="GI:289595707"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="GeneID:8826963"
FT                   /translation="MEIKWHGHSCFEIGEGTKIVIDPHDGRSLGIKAPVVKADVVLITH
FT                   HHFDHDAVRVVKGNFKVIDSPGEYEMGDVHIKGIPAYHDEQYGKKRGQITMYKIENEGI
FT                   KLLHVGDLGHVLTSEQLDEIGKIDILFTPVGGVYTVDAKKAYENVKLLKPKVVIPMHYK
FT                   VSGMTLGIQPLDPFISYFPEDKVEHVGNSINFTKEDLPRETQVWVFIR"
FT                   /protein_id="YP_003482403.1"
FT   misc_feature    complement(35745..36230)
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:174207"
FT                   /locus_tag="Aboo_0029"
FT   gene            36284..36817
FT                   /db_xref="GeneID:8826964"
FT                   /locus_tag="Aboo_0030"
FT   CDS_pept        36284..36817
FT                   /locus_tag="Aboo_0030"
FT                   /gene_family="HOG000219949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00537"
FT                   /codon_start="1"
FT                   /product="methylase"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0235 methyltransferase; TIGRFAM:
FT                   methylase; PFAM: methyltransferase small"
FT                   /db_xref="GI:289595708"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="GeneID:8826964"
FT                   /translation="MEVYPVSEDTLLMLDNIRCGKKVLEVGTGNGAIAIECAKSGSSVL
FT                   AVDIDKEAVKRLREEAKIKNLKIETKVSDLFENVDGKYDTIIFNPPYLPGNPKDLKDLQ
FT                   WAGGGKYGDEVILKFLDVAWKYLADDGEIYIILSSFNRLNKIFEMPYKFEKIAQKKFSF
FT                   HEIYLYRAKKIKER"
FT                   /protein_id="YP_003482404.1"
FT   misc_feature    36347..36694
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Aboo_0030"
FT   misc_feature    order(36359..36379,36425..36430,36500..36508,36548..36550)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Aboo_0030"
FT   gene            36829..37083
FT                   /db_xref="GeneID:8826965"
FT                   /locus_tag="Aboo_0031"
FT   CDS_pept        36829..37083
FT                   /locus_tag="Aboo_0031"
FT                   /gene_family="HOG000041924" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /codon_start="1"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   cma:Cmaq_1349 MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="GI:289595709"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="GeneID:8826965"
FT                   /translation="MEIKEAQKIIEEVYGEKDRERGVYADLVWLGEELGELFKAVRENK
FT                   SIEEEVADVFAWLLSVANVLGIDVEEAFKMKYLTSQGPP"
FT                   /protein_id="YP_003482405.1"
FT   misc_feature    36829..37059
FT                   /note="MazG nucleotide pyrophosphohydrolase domain; Region:
FT                   MazG; cl00737"
FT                   /db_xref="CDD:120075"
FT                   /locus_tag="Aboo_0031"
FT   gene            complement(37061..37642)
FT                   /db_xref="GeneID:8826966"
FT                   /locus_tag="Aboo_0032"
FT   CDS_pept        complement(37061..37642)
FT                   /locus_tag="Aboo_0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AF0353"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: afu:AF0353 hypothetical protein"
FT                   /db_xref="GI:289595710"
FT                   /db_xref="GeneID:8826966"
FT                   /translation="MSVNLKEIIDEMLDDSKIVMVLTKAELRALLGYTIVAHLLKDDNT
FT                   QGLYVALNIPHTSVEKRIRRMGADPSKLFFVDCITASIKTPEERNNVIYLNEPSAMLLE
FT                   GAIRHGLKVLEGERNFVYIESISTFLAYNTYQSFIRFLRMITNEIRLYGLVGIIFMLDK
FT                   ELEEVEFSQVTTFADDILDLRNLTREDLEM"
FT                   /protein_id="YP_003482406.1"
FT   gene            complement(37639..38331)
FT                   /db_xref="GeneID:8826967"
FT                   /locus_tag="Aboo_0033"
FT   CDS_pept        complement(37639..38331)
FT                   /locus_tag="Aboo_0033"
FT                   /gene_family="HOG000114569" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AF0354"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: afu:AF0354 hypothetical protein"
FT                   /db_xref="GI:289595711"
FT                   /db_xref="InterPro:IPR001553"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="GeneID:8826967"
FT                   /translation="MTVSVAPTGIKKLDEALGGGFPRNGISLVVGPSGIGKTILSVQWL
FT                   AEGVRNGETCVYISTTLPSEAVIAYYGDMKLLKDAVDKIHWYDMYISPKDLIPFTKEKI
FT                   LKIFHKVMPDFFDEQLNLKKPIDRLVLDSLTTIEKIVGDISMFRYLGATWIRFFHDNKI
FT                   STMLIEEMDEDGKKMGEMRNFSEATILMDFMEHQNMHMRALKIVKRYGFNHPTYWTPFH
FT                   IREEGIIL"
FT                   /protein_id="YP_003482407.1"
FT   misc_feature    complement(37690..38256)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Aboo_0033"
FT   misc_feature    complement(order(38218..38226,38236..38241))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Aboo_0033"
FT   misc_feature    complement(order(37933..37938,38152..38157,38161..38163,
FT                   38218..38226,38236..38238))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Aboo_0033"
FT   misc_feature    complement(37936..37950)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Aboo_0033"
FT   gene            38427..39146
FT                   /db_xref="GeneID:8826968"
FT                   /locus_tag="Aboo_0034"
FT   CDS_pept        38427..39146
FT                   /locus_tag="Aboo_0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sto:ST2612 hypothetical protein"
FT                   /db_xref="GI:289595712"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:8826968"
FT                   /translation="MIVINEHLEELEKYCIKDPTLHPFTLWDLRNEREETDFYVDWDNG
FT                   IRGYMLIYRGAAIPSVILHGSKSSMENLLQYFDEEKAIIHLPWNRRDIWKRDDKIYKIY
FT                   IMAATPKFYFLDGEVKEVKDSKILSYLFENPEYLVEKAKTYAIIKDGFAISSASALVYL
FT                   PEVWVLGAVITKKEYRNMGLASRVIGHFMSMAYQSTKNVALWVRSDNHIAIHLYEKYGF
FT                   KVKREDAWINVSVDILP"
FT                   /protein_id="YP_003482408.1"
FT   misc_feature    38871..39095
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Aboo_0034"
FT   gene            39272..39469
FT                   /db_xref="GeneID:8826969"
FT                   /locus_tag="Aboo_0035"
FT   CDS_pept        39272..39469
FT                   /locus_tag="Aboo_0035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:289595713"
FT                   /db_xref="GeneID:8826969"
FT                   /translation="MGNEIPKMPKNVEKWLKKHTVEDLEAALWELKGKKAEALAEILSI
FT                   LYEINDDLLGTEIPEIKALA"
FT                   /protein_id="YP_003482409.1"
FT   gene            39534..39606
FT                   /note="tRNA-Thr1"
FT                   /db_xref="GeneID:8826970"
FT                   /locus_tag="Aboo_R0002"
FT   tRNA            39534..39606
FT                   /db_xref="GeneID:8826970"
FT                   /locus_tag="Aboo_R0002"
FT                   /product="tRNA-Thr"
FT   gene            39610..40266
FT                   /db_xref="GeneID:8826971"
FT                   /locus_tag="Aboo_0036"
FT   CDS_pept        39610..40266
FT                   /locus_tag="Aboo_0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /codon_start="1"
FT                   /product="Putitive phosphate transport regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   pmo:Pmob_0285 hypothetical protein"
FT                   /db_xref="GI:289595714"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="GeneID:8826971"
FT                   /translation="MFKSKKEKEAIENYRKHASVALQCMDLFIKEVQALLDDDWEEMSK
FT                   LEREIYEKEREGDALRRKNEYLFSEGLLFPADRMTFINLSEQIDKVIDKIQQVSRIIGL
FT                   RKPSKEAIEFLKNSQIMDYLKVTQKSVKTMCESAISLLDNVHKAVEKAHEVEKYESQAD
FT                   ELKLELLRKLYGEENSIDVLSILQLEKMILWIDAISDKAEDASDVIILITAKMHP"
FT                   /protein_id="YP_003482410.1"
FT   misc_feature    39616..40254
FT                   /note="Protein of unknown function DUF47; Region: PhoU_div;
FT                   pfam01865"
FT                   /db_xref="CDD:110830"
FT                   /locus_tag="Aboo_0036"
FT   gene            complement(40250..41167)
FT                   /db_xref="GeneID:8826972"
FT                   /locus_tag="Aboo_0037"
FT   CDS_pept        complement(40250..41167)
FT                   /locus_tag="Aboo_0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /codon_start="1"
FT                   /product="phosphate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphate transporter; KEGG: tye:THEYE_A1362
FT                   sodium/phosphate symporter"
FT                   /db_xref="GI:289595715"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="GeneID:8826972"
FT                   /translation="MFAWIYIFLAALVSFIIAANNSANSVGALYGSDITSYNKAAIISG
FT                   TFVMLGVILEGWKMSGAIGGGIIEGELSAFMSIIVLITTLILLFVFTYLSMPLSASQIM
FT                   VGAVIGVALFYSLVINYPFLSLVVFSWIITFLAGLIFAYIIYHIIVRVAEGMHLFSLSK
FT                   FYTVSLYFGAAFIAYTLGANTIGLIASLTANYYVYVISGISAFFGTLLFGKRTVRTVGK
FT                   NITYLDPPRAFAALLGGALIVELFTQLHLPVSMTQAVIGGIVGTGFVKGYREINKNTIK
FT                   NLALSWILAPMLAFGVAYLLMGAF"
FT                   /protein_id="YP_003482411.1"
FT   sig_peptide     complement(41090..41167)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.462 at
FT                   residue 26"
FT                   /locus_tag="Aboo_0037"
FT   misc_feature    complement(40274..41119)
FT                   /note="Phosphate transporter family; Region: PHO4; cl00396"
FT                   /db_xref="CDD:153743"
FT                   /locus_tag="Aboo_0037"
FT   gene            complement(41201..41974)
FT                   /db_xref="GeneID:8826973"
FT                   /locus_tag="Aboo_0038"
FT   CDS_pept        complement(41201..41974)
FT                   /locus_tag="Aboo_0038"
FT                   /gene_family="HOG000245524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /codon_start="1"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   rca:Rcas_1939 DNA methylase N-4/N-6 domain-containing
FT                   protein"
FT                   /db_xref="GI:289595716"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="GeneID:8826973"
FT                   /translation="MKINDLDLRNWKNYDEIITDSLWLFPSRDNSGMHTPKYHGNFIPQ
FT                   IPRQAMLRFTKRGEWVLDTFAGLGTTLIEAKRLGRNAIGIEIDENTANMARELIEQEEN
FT                   PYNVYTDIIIGDSTKEETYEDLPNFQMVIIHPPYWDIIKFSKNNGDLSNSKTLNEFLER
FT                   FERVVYLSSQHLDEGRYLVLVIGDKYSKGEWVPLGFYCMNSVMKNGFKLKSIVVKNIEE
FT                   NRGKRGQYALWRYRALKDGYYIFKHEYVMFFVKDS"
FT                   /protein_id="YP_003482412.1"
FT   misc_feature    complement(41684..>41959)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Aboo_0038"
FT   misc_feature    complement(41447..41827)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Aboo_0038"
FT   misc_feature    complement(<41207..41590)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Aboo_0038"
FT   gene            complement(42007..42936)
FT                   /db_xref="GeneID:8826974"
FT                   /locus_tag="Aboo_0039"
FT   CDS_pept        complement(42007..42936)
FT                   /locus_tag="Aboo_0039"
FT                   /gene_family="HOG000277403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /codon_start="1"
FT                   /EC_number="2.7.2.2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: carbamate kinase; KEGG: tme:Tmel_1927
FT                   carbamate kinase-like carbamoyl phosphate synthetase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="GI:289595717"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="GeneID:8826974"
FT                   /translation="MKVVLAVGGNALLRPGDRGTAEEQMLRARQTAENIYPLFQKFKVV
FT                   VTHGNGPQVGAILLQNETAKNVVPPMPLDICGAMSQGEIGYMLEQSFQNVLEEKGVNKD
FT                   IATVLTRVIVDENDPAFENPTKPIGPFYTEEEAKRLAKEKGWHVIEDSGRGWRRVVPSP
FT                   MPLEIVEKDVIAELLEKGFGVIAVGGGGIPVIRKGRKLFGVEGVIDKDLASAVLARDIG
FT                   ADRLIILTSVEKVYLNFGKPEQRGIDEMSVQEAKKYMEEGHFKKGSMYPKILASVLYLD
FT                   NGGKEVLITSPEKVQDALDGKTGTWIYP"
FT                   /product="carbamate kinase"
FT                   /protein_id="YP_003482413.1"
FT   misc_feature    complement(42016..42933)
FT                   /note="AAK_CK: Carbamate kinase (CK) catalyzes both the
FT                   ATP-phosphorylation of carbamate and carbamoyl phosphate
FT                   (CP) utilization with the production of ATP from ADP and
FT                   CP. Both CK (this CD) and nonhomologous CP synthetase
FT                   synthesize carbamoyl phosphate, an...; Region: AAK_CK;
FT                   cd04235"
FT                   /db_xref="CDD:58601"
FT                   /locus_tag="Aboo_0039"
FT   misc_feature    complement(42016..42933)
FT                   /note="carbamate kinase; Reviewed; Region: PRK12686"
FT                   /db_xref="CDD:171663"
FT                   /locus_tag="Aboo_0039"
FT   misc_feature    complement(order(42304..42312,42559..42561,42784..42792,
FT                   42910..42915,42919..42921))
FT                   /note="putative substrate binding site; other site"
FT                   /db_xref="CDD:58601"
FT                   /locus_tag="Aboo_0039"
FT   misc_feature    complement(order(42121..42123,42130..42135,42145..42147,
FT                   42220..42222,42229..42231,42244..42249,42910..42912))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:58601"
FT                   /locus_tag="Aboo_0039"
FT   misc_feature    complement(order(42121..42123,42130..42135,42145..42147,
FT                   42220..42222,42229..42231,42244..42249,42910..42912))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:58601"
FT                   /locus_tag="Aboo_0039"
FT   misc_feature    complement(order(42328..42330,42334..42336,42418..42420,
FT                   42427..42429,42604..42606,42610..42618,42655..42657,
FT                   42667..42672,42679..42681,42688..42693,42703..42705,
FT                   42712..42717,42724..42726,42760..42762))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:58601"
FT                   /locus_tag="Aboo_0039"
FT   gene            43079..43414
FT                   /db_xref="GeneID:8826975"
FT                   /locus_tag="Aboo_0040"
FT   CDS_pept        43079..43414
FT                   /locus_tag="Aboo_0040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: btk:BT9727_4544 thiamine transporter"
FT                   /db_xref="GI:289595718"
FT                   /db_xref="GeneID:8826975"
FT                   /translation="MKRKVILLDIIWLLISAFLIYMALEIDAALSFIISLFFFGASYLF
FT                   SGISDYGRGNPYKGMMLSPQPNEIEYSSYKMAYEKEMGKKNKGKVNWLILILGVITFVF
FT                   TFYLILF"
FT                   /protein_id="YP_003482414.1"
FT   gene            complement(43417..44352)
FT                   /db_xref="GeneID:8826976"
FT                   /locus_tag="Aboo_0041"
FT   CDS_pept        complement(43417..44352)
FT                   /locus_tag="Aboo_0041"
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00321"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.46"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: deoxyhypusine synthase; KEGG: pto:PTO1252
FT                   putative deoxyhypusine synthase; PFAM: deoxyhypusine
FT                   synthase"
FT                   /db_xref="GI:289595719"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="GeneID:8826976"
FT                   /translation="MNIEEHIPVKDIKIHEGMTAGELMDELYSSGGFVAKHLAVAEKIL
FT                   LKMFKEENTTFLSFPACIIATGTRGVIKEIVRRKLVDVIITTCGMLDHDIARSFKNYYH
FT                   GSFLMDDTALHREGVNRLGNVLVPNESYGVVMENFMMPILEELYKEKKEWGGRELIDEF
FT                   AKRMNNEDSILYWAHKNKIPIYVPGITDGSFGSQLWSFREMHPDFRVDVLKDEHELADI
FT                   IFDAKKTGALMIGGGISKHHTIWWNQFRDGLDYAVYITTAVEWDGSLSGARVREAVSWG
FT                   KVREDAKYVTVEGDATVLLPLLITSVLEKL"
FT                   /product="deoxyhypusine synthase"
FT                   /protein_id="YP_003482415.1"
FT   misc_feature    complement(43420..44331)
FT                   /note="Deoxyhypusine synthase; Region: DS; cl00826"
FT                   /db_xref="CDD:176586"
FT                   /locus_tag="Aboo_0041"
FT   misc_feature    complement(43429..44331)
FT                   /note="putative deoxyhypusine synthase; Provisional;
FT                   Region: PRK01221"
FT                   /db_xref="CDD:167184"
FT                   /locus_tag="Aboo_0041"
FT   gene            complement(44349..45365)
FT                   /db_xref="GeneID:8826977"
FT                   /locus_tag="Aboo_0042"
FT   CDS_pept        complement(44349..45365)
FT                   /locus_tag="Aboo_0042"
FT                   /gene_family="HOG000228238" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /codon_start="1"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0226 tyrosyl-tRNA synthetase; TIGRFAM:
FT                   tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA synthetase
FT                   class Ib"
FT                   /db_xref="GI:289595720"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016485"
FT                   /db_xref="GeneID:8826977"
FT                   /translation="MLSWEIMRNVEEVITLEEFENALKGNPKGYVGLEPSGRVHLGTGL
FT                   IIGNKVKDLMDNGVDMIVFLADWHAMINDKFGGDIEKIRLAGEYMKGVFSALGIRPRYI
FT                   WADELVSKKEYWEKVIRVAKKTTLKRVKRAMTIMGRKEDEAELDSSKIIYPFMQVSDIF
FT                   DMELDIALGGMDQRHAHMLARDLADKLGYKKPVAIHTVLLASLKGAGRMDPAEAKMSKS
FT                   KEGSAIFVEDTEDDIRRKMKKAFCPPEIEGNPVLQIAKHVLFAYYIEKLVIPRPEKWGG
FT                   DLVINSYEELEKIYGEGELHPMDLKNAVANELIRILKPIRDYIEKNDDIPRALGWIK"
FT                   /protein_id="YP_003482416.1"
FT   misc_feature    complement(44385..45353)
FT                   /note="tyrosyl-tRNA synthetase; Region: tyrS; TIGR00234"
FT                   /db_xref="CDD:161781"
FT                   /locus_tag="Aboo_0042"
FT   misc_feature    complement(44418..45287)
FT                   /note="nucleotidyl transferase superfamily; Region:
FT                   nt_trans; cl00015"
FT                   /db_xref="CDD:173983"
FT                   /locus_tag="Aboo_0042"
FT   misc_feature    complement(order(44697..44708,45237..45248))
FT                   /note="active site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="Aboo_0042"
FT   misc_feature    complement(order(44703..44705,45237..45239,45246..45248))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="Aboo_0042"
FT   misc_feature    complement(45237..45248)
FT                   /note="HIGH motif; other site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="Aboo_0042"
FT   misc_feature    complement(44697..44708)
FT                   /note="KMSKS motif; other site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="Aboo_0042"
FT   gene            45436..46143
FT                   /db_xref="GeneID:8826978"
FT                   /locus_tag="Aboo_0043"
FT   CDS_pept        45436..46143
FT                   /locus_tag="Aboo_0043"
FT                   /gene_family="HOG000229630" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00050"
FT                   /codon_start="1"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /transl_table="11"
FT                   /note="KEGG: mst:Msp_1047 rRNA methylase; TIGRFAM: RNA
FT                   methyltransferase, TrmH family, group 1; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU)"
FT                   /db_xref="GI:289595721"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="GeneID:8826978"
FT                   /translation="MQIHIVFVEPQFTGNIGFLARTMANFGFKNLILVNPPELDEDAYR
FT                   FSKHARYIIENAEILNNFEELRRSLDYLVATSGVSTKSPKKFKRIALTPREFAQKVWNF
FT                   SGNIGIVFGRENYGLYNEEIEKCDSLITIPTSEEYPIMNITHAAAIILYEIFMEKREEE
FT                   GMPLAEEFELNLLNERFSELLGLINFPDHKRKNTEVMFRRIIGRAMLTKWEYHSMMGVM
FT                   KRIIYAIQAKDDY"
FT                   /protein_id="YP_003482417.1"
FT   misc_feature    45436..46137
FT                   /note="rRNA methylase [Translation, ribosomal structure and
FT                   biogenesis]; Region: LasT; COG0565"
FT                   /db_xref="CDD:30911"
FT                   /locus_tag="Aboo_0043"
FT   misc_feature    45439..45894
FT                   /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
FT                   cl00362"
FT                   /db_xref="CDD:174147"
FT                   /locus_tag="Aboo_0043"
FT   gene            46176..47321
FT                   /db_xref="GeneID:8826979"
FT                   /locus_tag="Aboo_0044"
FT   CDS_pept        46176..47321
FT                   /locus_tag="Aboo_0044"
FT                   /gene_family="HOG000073591" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /codon_start="1"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: mac:MA2085 cation efflux system protein;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: cation efflux protein; Dinitrogenase iron-molybdenum
FT                   cofactor biosynthesis protein"
FT                   /db_xref="GI:289595722"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="GeneID:8826979"
FT                   /translation="MTKNEVFEYGERIARNVTTITLILAILKFIVAYYTHSVSILADSY
FT                   HSFADLIPISAAWIGLRIAQRPRSEKFPYGYYKAENLAAFIASIFIFLLAYEIITKSIS
FT                   TFSSKNTVEHSIAGLILTAIFVLISYILYIYQLKAAKISNSQALMANARETKMDIFSSI
FT                   AVFIGFFGSSMGYPWIGGIVGFLIAILVIHAGYQSIRDSVLSLMDAGLPKEDIEKIRKI
FT                   ILSTPRVREVKKIYTRRSGPFIMVEVEISVPEKLNVKQAHEIASEVEKRIMQIKQVDHA
FT                   FVHVEPPTKSRKIIAIPVNKDHSPSPTFGSAPYFEIYQVEKDEKKLIKTVKNPGANLEK
FT                   KRGVKAALFLIEQGVDEVHTKNIGEDSKKILEDAGIKIKFK"
FT                   /protein_id="YP_003482418.1"
FT   misc_feature    46176..47054
FT                   /note="Cation efflux family; Region: Cation_efflux;
FT                   cl00316"
FT                   /db_xref="CDD:174105"
FT                   /locus_tag="Aboo_0044"
FT   misc_feature    47055..47309
FT                   /note="This uncharacterized conserved protein belongs to a
FT                   family of iron-molybdenum cluster-binding proteins that
FT                   includes NifX, NifB, and NifY, all of which are involved in
FT                   the synthesis of an iron-molybdenum cofactor (FeMo-co) that
FT                   binds the active site of...; Region: MTH1175; cd00851"
FT                   /db_xref="CDD:29645"
FT                   /locus_tag="Aboo_0044"
FT   gene            47606..47818
FT                   /db_xref="GeneID:8826980"
FT                   /locus_tag="Aboo_0045"
FT   CDS_pept        47606..47818
FT                   /locus_tag="Aboo_0045"
FT                   /gene_family="HOG000073909" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:TON_0920"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ton:TON_0920 hypothetical protein"
FT                   /db_xref="GI:289595723"
FT                   /db_xref="GeneID:8826980"
FT                   /translation="MPRYGYGRGYRGSALSLYSLVDIAIIAGIIYLLISLFMVAAGYVI
FT                   ALIVLILLREFLRGRFNWRRMYVWR"
FT                   /protein_id="YP_003482419.1"
FT   gene            47825..48196
FT                   /db_xref="GeneID:8826981"
FT                   /locus_tag="Aboo_0046"
FT   CDS_pept        47825..48196
FT                   /locus_tag="Aboo_0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tsi:TSIB_0698 iron-molybdenum cofactor-binding
FT                   protein"
FT                   /db_xref="GI:289595724"
FT                   /db_xref="GeneID:8826981"
FT                   /translation="MYRYYGYGYYGPGFGWGRGRGRGWGRGFGRGFGMGRGYGATLGYC
FT                   PWTGLPRGWRWNYPYGYGTSVSPYYPRYYPQYYGLNPYAQYYQPYPQANERELLENEAR
FT                   NLEERLRDIERRIREIKGE"
FT                   /protein_id="YP_003482420.1"
FT   gene            48198..48671
FT                   /db_xref="GeneID:8826982"
FT                   /locus_tag="Aboo_0047"
FT   CDS_pept        48198..48671
FT                   /locus_tag="Aboo_0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /codon_start="1"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: adg:Adeg_1087 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein"
FT                   /db_xref="GI:289595725"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="GeneID:8826982"
FT                   /translation="MRVAITADAPDENSPISPIFGRCAYYAIYDTATDKLEFVPNASAM
FT                   YARGAGVQAAQQIANLGVQTVITSGIAGPNASMVLAQAGIQVINSFQGTIRDAIEAVKS
FT                   GRIYSEPPRAFPPPQPPYPPISKEEELRMLEEEKEYIEKRLEEIKKKLEELKE"
FT                   /protein_id="YP_003482421.1"
FT   misc_feature    48198..48506
FT                   /note="This uncharacterized conserved protein belongs to a
FT                   family of iron-molybdenum cluster-binding proteins that
FT                   includes NifX, NifB, and NifY, all of which are involved in
FT                   the synthesis of an iron-molybdenum cofactor (FeMo-co) that
FT                   binds the active site of...; Region: MTH1175; cd00851"
FT                   /db_xref="CDD:29645"
FT                   /locus_tag="Aboo_0047"
FT   gene            48740..49447
FT                   /db_xref="GeneID:8826983"
FT                   /locus_tag="Aboo_0048"
FT   CDS_pept        48740..49447
FT                   /locus_tag="Aboo_0048"
FT                   /gene_family="HOG000226626" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09054"
FT                   /codon_start="1"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /transl_table="11"
FT                   /note="PFAM: KaiA binding; Circadian clock protein KaiC
FT                   central region; KEGG: mbu:Mbur_1755 ATPase"
FT                   /db_xref="GI:289595726"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR015140"
FT                   /db_xref="GeneID:8826983"
FT                   /translation="MRIRTGIPGFDELVQGGLVAQRVYIIAGPPGSGKTTFGIQFLLQG
FT                   AKEGERGLFVSLTEDPKTIIEDISTFNLSLKRYALSGHILFVDMGPLSIQNLNGVKSPE
FT                   SIKSAYAQEVFRRIYAIVKAKGIKRLVIDSVLTLKYGEKSLEDESKEIARFFRSLKDLK
FT                   ITVLILSEMTDLSNYTPEHYMAHGLIFLHNFLNGHTMTRAIQIIKMRGTAHDCDMHKME
FT                   ITQNGIRVYSTKV"
FT                   /protein_id="YP_003482422.1"
FT   misc_feature    48740..49444
FT                   /note="RecA-superfamily ATPases implicated in signal
FT                   transduction [Signal transduction mechanisms]; Region:
FT                   RAD55; COG0467"
FT                   /db_xref="CDD:30815"
FT                   /locus_tag="Aboo_0048"
FT   misc_feature    48806..49384
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Aboo_0048"
FT   misc_feature    order(48821..48826,48836..48844)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Aboo_0048"
FT   misc_feature    order(48824..48826,48836..48844,48899..48901,48905..48910,
FT                   49136..49141)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Aboo_0048"
FT   misc_feature    49124..49138
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Aboo_0048"
FT   gene            49451..50113
FT                   /db_xref="GeneID:8826984"
FT                   /locus_tag="Aboo_0049"
FT   CDS_pept        49451..50113
FT                   /locus_tag="Aboo_0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08271"
FT                   /codon_start="1"
FT                   /product="Zinc finger TFIIB-type domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Zinc finger TFIIB-type domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="GI:289595727"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="GeneID:8826984"
FT                   /translation="MKCPICGSTNVTKLKTGSYRCNDCGFVFYPTREVIIDMRDLLTGD
FT                   ELTEEEINELGEKIKEQTENVSEKIFGKSAKNVFRALSSLDEILAQYNEDDRVFGIFAD
FT                   FSGSVKGTVMIMVQENEIDIIKKIYRKKEVIEALKQLGKETAEGFKEIFQDDLFLEGVD
FT                   IAYDTIPSIINYLISEIAGERNMILNVKMIVDKAPKGEIIFVPQKDSIKYLKSVLGN"
FT                   /protein_id="YP_003482423.1"
FT   misc_feature    <49454..49534
FT                   /note="Putative transposase DNA-binding domain; Region:
FT                   Transposase_35; pfam07282"
FT                   /db_xref="CDD:115907"
FT                   /locus_tag="Aboo_0049"
FT   gene            complement(50272..50625)
FT                   /db_xref="GeneID:8826985"
FT                   /locus_tag="Aboo_0050"
FT   CDS_pept        complement(50272..50625)
FT                   /locus_tag="Aboo_0050"
FT                   /gene_family="HOG000073590" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:TK2041"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tko:TK2041 hypothetical protein"
FT                   /db_xref="GI:289595728"
FT                   /db_xref="GeneID:8826985"
FT                   /translation="MSEKKEDILKRAYLLGYEVGYYGHYESIGWVRRELRKLESLAKEE
FT                   GIEYELWEVYRRGKEDSRKARSYEITEGKEIPVEDISVNIRAERTMIRAIRRQDRRIKT
FT                   LSLPRFLKRRYHF"
FT                   /protein_id="YP_003482424.1"
FT   gene            complement(50635..52275)
FT                   /db_xref="GeneID:8826986"
FT                   /locus_tag="Aboo_0051"
FT   CDS_pept        complement(50635..52275)
FT                   /locus_tag="Aboo_0051"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /codon_start="1"
FT                   /product="flagellin"
FT                   /transl_table="11"
FT                   /note="PFAM: flagellin; KEGG: cth:Cthe_1235 cellulose
FT                   1,4-beta-cellobiosidase"
FT                   /db_xref="GI:289595729"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="GeneID:8826986"
FT                   /translation="MKKIYRKEEGDIGIATLILFIAIIIVAAIASSLIIYVGVTLREQG
FT                   EKVASDVTSQITSSLRILNILGDRDIDGKDPSVVSVKAPIHSDTQPPRGGVILNVSVNS
FT                   TNPLSVKIVWNSAVDWESGMWKEELYRVSGDSFTAVKYIVKDVNYIKAVGNLVATFTSG
FT                   FGNDRVYVDYGVNASKYYGYAIIGYDRVGNYVLYSAVNQTVYTGTGTPDTSAPTGSINS
FT                   ITPAGYGVMLSWTASDTGGSGIAYQKIYRSNNEITQSDVNYTKKIINNATLVATVGPNV
FT                   TAYMDYPPAKGTWYYAILVVDKAGNVGFITKTSGVNVTRVDTTKPSSISGLRAETSQYY
FT                   IHLEWSAAKDNQSGIKAYYIYRSTNYLDVSTTEVFNTKPYAIVNTTSFNDYRYMPYQTY
FT                   YYLVVPVDNASHYGQIIVPQNSIQVLQIKLSLGPGSKPVDFNTVIVELTDGKVEASLKL
FT                   NSSGFGVEAADATHYGVSVINDPSGEFTQSYILEEGAIIVMYINARDVGLTLTPQTKLT
FT                   MKIIPGLGIPIYKVISIPPVMLNRYVQIY"
FT                   /protein_id="YP_003482425.1"
FT   misc_feature    complement(50695..>51021)
FT                   /note="Archaebacterial flagellin; Region: Arch_flagellin;
FT                   cl00732"
FT                   /db_xref="CDD:174366"
FT                   /locus_tag="Aboo_0051"
FT   gene            52377..53327
FT                   /db_xref="GeneID:8826987"
FT                   /locus_tag="Aboo_0052"
FT   CDS_pept        52377..53327
FT                   /locus_tag="Aboo_0052"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.26"
FT                   /transl_table="11"
FT                   /note="KEGG: ate:Athe_2388 D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region"
FT                   /db_xref="GI:289595730"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8826987"
FT                   /translation="MKIFLTRKIPDDGIKILKNAGLDIEIFPYDRIPKKEEIIAGIKDA
FT                   DALISLLADRIDKEIIDSAPKLKVIGNYAVGYNNIDVEYAKKKGIIVTNTPGVLTDATA
FT                   DLTFALILAAARRVVEGDKFMRQRKFKGWAPTLMLGKDVWGATIGIIGAGRIGQAVAKR
FT                   AKGFNMRILYYSRKRKEEMDGLGAKFVSLEELLRESDIITLHVPFTPDTRHLIDYEEFE
FT                   IMKDGAILINTARGEVVNEEVMLKALKSGKLFAAGLDVFYNEPKVNPELFKLDNVVLTP
FT                   HIGSATERTRRKMAEMVCSDVVRVLRGEEPMNRVV"
FT                   /product="Glyoxylate reductase"
FT                   /protein_id="YP_003482426.1"
FT   misc_feature    52380..53321
FT                   /note="glyoxylate reductase; Reviewed; Region: PRK13243"
FT                   /db_xref="CDD:171921"
FT                   /locus_tag="Aboo_0052"
FT   misc_feature    52698..53228
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Aboo_0052"
FT   gene            53498..53746
FT                   /db_xref="GeneID:8826988"
FT                   /locus_tag="Aboo_0053"
FT   CDS_pept        53498..53746
FT                   /locus_tag="Aboo_0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:TSIB_1172"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tsi:TSIB_1172 hypothetical protein"
FT                   /db_xref="GI:289595731"
FT                   /db_xref="GeneID:8826988"
FT                   /translation="MLSTTLLVDVIILVFTGIKLLFSPSRKEGIEASWRLLGVKLTTLE
FT                   LIHVVAGFLMAGLVIIHFALNYTMYKNEMKMLFSSKK"
FT                   /protein_id="YP_003482427.1"
FT   gene            complement(53778..55025)
FT                   /db_xref="GeneID:8826989"
FT                   /locus_tag="Aboo_0054"
FT   CDS_pept        complement(53778..55025)
FT                   /locus_tag="Aboo_0054"
FT                   /gene_family="HOG000018073" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.21"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase; KEGG: rci:LRC67
FT                   histidyl-tRNA synthetase; PFAM: tRNA synthetase class II (G
FT                   H P and S); Anticodon-binding domain protein"
FT                   /db_xref="GI:289595732"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="GeneID:8826989"
FT                   /translation="MLQRLRGFRDMYPEYMRARRIVFDKICSVARSFGFHEVDTPSVEL
FT                   LDLFRIKSGEEIVKQTFSFVDKGGREITLIPELTPSVSRMIAARKDLIKPVKWFSFPKM
FT                   WRYEEPQSGRLREFYQFNADIFGVANITADAEVMALAMEILDSLGLKGKYVMKFSDRIL
FT                   MEELLRSLNIEKIEEAFRIIDKKDKIPEERFYEEMLKITSEENVDSLISLLKLSGDVDT
FT                   ILSKFEHFERSEILASLKDLLKAYGKTATLDLSIVRGLAYYTGVVFEVHDANGEFRAVL
FT                   GGGRYDRVVELFGAQPTPAVGFGMGDAVLELLMRREGVWPEEKIEVDYFIAIIPGFRKE
FT                   AIEIAMELRRSGCVVDIDLSRRSIGKQLKYAHRINAKYTIIVGEEIKNGEVALKDMESG
FT                   EQRNVKIGELKEVIEK"
FT                   /product="histidyl-tRNA synthetase"
FT                   /protein_id="YP_003482428.1"
FT   misc_feature    complement(53829..55019)
FT                   /note="histidyl-tRNA synthetase; Region: hisS; TIGR00442"
FT                   /db_xref="CDD:161881"
FT                   /locus_tag="Aboo_0054"
FT   misc_feature    complement(54081..54980)
FT                   /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
FT                   catalytic core domain. HisRS is a homodimer. It is
FT                   responsible for the attachment of histidine to the 3' OH
FT                   group of ribose of the appropriate tRNA. This domain is
FT                   primarily responsible for ATP-dependent...; Region:
FT                   HisRS-like_core; cd00773"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Aboo_0054"
FT   misc_feature    complement(order(54117..54122,54174..54176,54609..54611,
FT                   54618..54620,54630..54632,54654..54656,54675..54680,
FT                   54759..54764,54771..54776,54789..54791,54795..54797,
FT                   54831..54836,54897..54917,54930..54932,54966..54968))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Aboo_0054"
FT   misc_feature    complement(54897..54923)
FT                   /note="motif 1; other site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Aboo_0054"
FT   misc_feature    complement(order(54099..54101,54108..54110,54117..54119,
FT                   54174..54176,54189..54191,54237..54242,54246..54248,
FT                   54252..54254,54654..54656,54666..54668,54672..54674,
FT                   54681..54683,54702..54704,54708..54710,54789..54791,
FT                   54795..54797))
FT                   /note="active site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Aboo_0054"
FT   misc_feature    complement(54699..54713)
FT                   /note="motif 2; other site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Aboo_0054"
FT   misc_feature    complement(order(54099..54101,54108..54122))
FT                   /note="motif 3; other site"
FT                   /db_xref="CDD:73226"
FT                   /locus_tag="Aboo_0054"
FT   misc_feature    complement(53787..54050)
FT                   /note="HisRS Histidyl-anticodon binding domain. HisRS
FT                   belongs to class II aminoacyl-tRNA synthetases (aaRS). This
FT                   alignment contains the anticodon binding domain, which is
FT                   responsible for specificity in tRNA-binding, so that the
FT                   activated amino acid is...; Region: HisRS_anticodon;
FT                   cd00859"
FT                   /db_xref="CDD:29799"
FT                   /locus_tag="Aboo_0054"
FT   misc_feature    complement(order(53844..53846,53850..53852,53877..53879,
FT                   53901..53903,53919..53921,54024..54026))
FT                   /note="anticodon binding site; other site"
FT                   /db_xref="CDD:29799"
FT                   /locus_tag="Aboo_0054"
FT   gene            55094..56434
FT                   /db_xref="GeneID:8826990"
FT                   /locus_tag="Aboo_0055"
FT   CDS_pept        55094..56434
FT                   /locus_tag="Aboo_0055"
FT                   /gene_family="HOG000056140" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /codon_start="1"
FT                   /product="MATE efflux family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tsi:TSIB_0514 sodium-driven multidrug efflux
FT                   pump protein; TIGRFAM: MATE efflux family protein; PFAM:
FT                   multi antimicrobial extrusion protein MatE"
FT                   /db_xref="GI:289595733"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="GeneID:8826990"
FT                   /translation="MNVQLRRIVLKLAIPAVISNLLYTFQNIVDAMMLGRYGNPAISLS
FT                   AAGIGGMLYFLTFPLIMGLATGGVAIMARRWGEKNYKEAKFTFENLYILLILISIPISL
FT                   FGVFLGWTLPTALGADKAVINASYHYIMGIFIFYPFAVFLAVYNSAMRAAGDTKTPMIV
FT                   DIYANSWNVFWNYTLIFGNFGFPELGVMGAGIATGSSYLFASLIYLIMQNRGKLIISPN
FT                   LLSREKGDVKMMKKIFRIGIPAGIERGMWAITSFIYTFLIFLASGPIGYASFQVGLKAE
FT                   SVAYMPAFGFSIAATTLVGQYLGERNIEKARSAAIEATKMSMLFMGIAGAFMVFFPKYL
FT                   AELFTGDAEIIHLASIYLLLMGMTEPALGALFTLAGGMRGAGYTTMPMIINLTGLMGVR
FT                   LGIAVLLAFPLGMGLIGIWLGMFVETFIRAIWMFLEFRRGKWAKVKV"
FT                   /protein_id="YP_003482429.1"
FT   misc_feature    55094..56431
FT                   /note="Na+-driven multidrug efflux pump [Defense
FT                   mechanisms]; Region: NorM; COG0534"
FT                   /db_xref="CDD:30880"
FT                   /locus_tag="Aboo_0055"
FT   misc_feature    55136..55624
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="Aboo_0055"
FT   misc_feature    55847..56278
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="Aboo_0055"
FT   gene            56475..56548
FT                   /note="tRNA-Ala1"
FT                   /db_xref="GeneID:8826991"
FT                   /locus_tag="Aboo_R0003"
FT   tRNA            56475..56548
FT                   /db_xref="GeneID:8826991"
FT                   /locus_tag="Aboo_R0003"
FT                   /product="tRNA-Ala"
FT   gene            complement(56704..57846)
FT                   /db_xref="GeneID:8826992"
FT                   /locus_tag="Aboo_0056"
FT   CDS_pept        complement(56704..57846)
FT                   /locus_tag="Aboo_0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rca:Rcas_3883 multi-sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="GI:289595734"
FT                   /db_xref="GeneID:8826992"
FT                   /translation="MWFTYASSISLVATVISAVLVYLILKANIKKPGNLAAFVMFLGVL
FT                   IWSFGELLERIAGPPPADETLAYLGALTLCVGIFITPAGLIHFAIDYPYRIKMKASTRK
FT                   YILYAVYILSFVGIALIPFNSLLGNIVIRGVSPYNALGIIIWGLESSVLHKFFATWDFI
FT                   AALIMIGILVMKLKGVDMYIIKNQIIITLIGFLIMFFMVVFTSFVPTMMNINMYPLNTL
FT                   AFSIFGLFVIYTVHRYRLFLVAPVQEEAVESEEMPDMGIYEMKKDEAYHKFMLLVKSGN
FT                   TGVAFISENAEDFKKKHGLKNTSIYEISKEGGKNRLNPENKEHMEMIGFIITSLLEQVY
FT                   KPVILLDLSEPWLKEETRKILKEKIQNISSVYGGVYLLVG"
FT                   /protein_id="YP_003482430.1"
FT   gene            57959..58210
FT                   /db_xref="GeneID:8826993"
FT                   /locus_tag="Aboo_0057"
FT   CDS_pept        57959..58210
FT                   /locus_tag="Aboo_0057"
FT                   /gene_family="HOG000044611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /codon_start="1"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_0018 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein"
FT                   /db_xref="GI:289595735"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:8826993"
FT                   /translation="MSEQKAKPPKKRGKVTIDEKRCKGCWYCIEYCPTKVLQVSEHLNE
FT                   KGYHPPKLVEEPPNKVCIACHLCELYCPDFAIIVEEIK"
FT                   /protein_id="YP_003482431.1"
FT   misc_feature    <57998..58198
FT                   /note="RPB11 and RPB3 subunits of RNA polymerase; Region:
FT                   RNAP_RPB11_RPB3; cl11409"
FT                   /db_xref="CDD:175243"
FT                   /locus_tag="Aboo_0057"
FT   gene            58207..59325
FT                   /db_xref="GeneID:8826994"
FT                   /locus_tag="Aboo_0058"
FT   CDS_pept        58207..59325
FT                   /locus_tag="Aboo_0058"
FT                   /gene_family="HOG000223606" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /codon_start="1"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: mth:MTH1033 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit alpha"
FT                   /db_xref="GI:289595736"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="GeneID:8826994"
FT                   /translation="MKPGYYFWSGDIAAAEGAIAAGCRFYAGYPITPSSEIAERMALRL
FT                   PQEGGKFIEMEDEIGSIAAIIGASWTGKKVMTATAGPGISLMNENIGLAAMTEVPIVVV
FT                   NAMRGAPSTGLPTLIGQGDLMQAKWGSHGSYEIISLYPDSVQETFDLMIDAFNYAEKYR
FT                   VPVMFLIDAMLAHMYEKIYVPPDDEIVRIERKRPTTPPGETLIYKADDDLIPPMPRIGE
FT                   GYKIHASGLTHNEKGYPELTPQAQEKLVKRLNDKIRKHAEEIWKVEEYKTDDADVIVIA
FT                   MGSESRSVRFAVDLARREGIKAGMLRLITIWPFPYKFIEKYNVHYIVAEINYGQIYHKV
FT                   REYTKDVELLPKMGGEIHKPEEVLKAIRRGVQ"
FT                   /protein_id="YP_003482432.1"
FT   misc_feature    58210..59313
FT                   /note="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   alpha; Validated; Region: PRK08659"
FT                   /db_xref="CDD:169542"
FT                   /locus_tag="Aboo_0058"
FT   misc_feature    58273..58722
FT                   /note="Pyrimidine (PYR) binding domain of pyruvate
FT                   ferredoxin oxidoreductase (PFOR), indolepyruvate ferredoxin
FT                   oxidoreductase alpha subunit (IOR-alpha), and related
FT                   proteins; Region: TPP_PYR_PFOR_IOR-alpha_like; cd07034"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Aboo_0058"
FT   misc_feature    order(58279..58284,58300..58302,58312..58314,58321..58323,
FT                   58363..58374,58393..58398,58402..58410,58417..58419,
FT                   58423..58425,58474..58476,58483..58485,58495..58497,
FT                   58534..58539,58588..58593)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Aboo_0058"
FT   misc_feature    order(58279..58284,58291..58296,58300..58302,58318..58323,
FT                   58363..58374,58393..58398,58402..58410,58417..58419,
FT                   58423..58425,58474..58476,58483..58485)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Aboo_0058"
FT   misc_feature    order(58294..58296,58378..58380)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Aboo_0058"
FT   misc_feature    order(58300..58302,58528..58530)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:132917"
FT                   /locus_tag="Aboo_0058"
FT   gene            59322..60158
FT                   /db_xref="GeneID:8826995"
FT                   /locus_tag="Aboo_0059"
FT   CDS_pept        59322..60158
FT                   /locus_tag="Aboo_0059"
FT                   /gene_family="HOG000007085" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /codon_start="1"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: sfu:Sfum_0016 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="GI:289595737"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="GeneID:8826995"
FT                   /translation="MNPMEEMRKEQEKLLRTDRLPHVWCPGCGIGIVLNAFLRAFIRSK
FT                   MDPNKLVVVSGIGCTGRAAGYVNVDSFHTTHGRGIPFAVGIKFARPDLNVVVFSGDGDL
FT                   FAIGGNHFVNAARRNHDLLIIAVNNFTYGMTGGQHGPTTPTGAYTTTTPYGNPDRPFNI
FT                   PHLAISLGAPYVARWTTYHVNQIQNSIYHALHKKGFRVIEIISQCPTVYGRRNDMKTPL
FT                   EMMHYFQKNSVRKDDASFEELELSYNGKIVVGVFRDVQGIPTYEERYEDIIRRARK"
FT                   /protein_id="YP_003482433.1"
FT   misc_feature    59358..60155
FT                   /note="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   beta; Validated; Region: PRK05778"
FT                   /db_xref="CDD:168241"
FT                   /locus_tag="Aboo_0059"
FT   misc_feature    59391..59951
FT                   /note="Thiamine pyrophosphate (TPP family), 2-oxoglutarate
FT                   ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding
FT                   module; OGFOR catalyzes the oxidative decarboxylation of
FT                   2-oxo-acids, with ferredoxin acting as an electron
FT                   acceptor. In the TCA cycle, OGFOR...; Region: TPP_OGFOR;
FT                   cd03375"
FT                   /db_xref="CDD:73355"
FT                   /locus_tag="Aboo_0059"
FT   misc_feature    order(59547..59549,59619..59630,59706..59708,59712..59714)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:73355"
FT                   /locus_tag="Aboo_0059"
FT   gene            60155..60700
FT                   /db_xref="GeneID:8826996"
FT                   /locus_tag="Aboo_0060"
FT   CDS_pept        60155..60700
FT                   /locus_tag="Aboo_0060"
FT                   /gene_family="HOG000228812" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02175"
FT                   /codon_start="1"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: mfe:Mefer_0782 pyruvate/ketoisovalerate
FT                   oxidoreductase, gamma subunit; TIGRFAM:
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate/ketoisovalerate oxidoreductase"
FT                   /db_xref="GI:289595738"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="GeneID:8826996"
FT                   /translation="MRIEIKFGGLGGQGIITAGYITAKAAAIYDGKESAFTQDYSAEAR
FT                   GGASTSEVIISNEKITYPQVLNADYLVLMSQSAYRDYLDKLKEGGTLIIDEDLVKPDEK
FT                   AKNFKIYKIPATRFAEEIGNSIVANIVMLGFFTAITGVVSKDAMWKSIEERIPKRFLEL
FT                   NERAFLKGYDYGEKMKKE"
FT                   /protein_id="YP_003482434.1"
FT   misc_feature    60215..60676
FT                   /note="Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   Region: POR; cl00546"
FT                   /db_xref="CDD:174278"
FT                   /locus_tag="Aboo_0060"
FT   gene            complement(60703..62004)
FT                   /db_xref="GeneID:8826997"
FT                   /locus_tag="Aboo_0061"
FT   CDS_pept        complement(60703..62004)
FT                   /locus_tag="Aboo_0061"
FT                   /gene_family="HOG000239403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /codon_start="1"
FT                   /EC_number="2.1.2.1"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0611 serine hydroxymethyltransferase;
FT                   PFAM: glycine hydroxymethyltransferase"
FT                   /db_xref="GI:289595739"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="GeneID:8826997"
FT                   /translation="MSLEDALKIKELVKKHTEWFRDSLPMIASENLISPMAQEFLISDL
FT                   HNRYAEGLPGKRYYQGNIYVDQIEELTTELAKKLFKVDYADVRPISGTNANQAVLFALT
FT                   KPGDVITGPPLQGGAHISSAKFGAVGMRGVHKIEYPFDVEEMNIDVDMSAKLIKIVKPK
FT                   VALFGMSVFLFPAPLKELQDAFQEAGTTVWYDGAHVLGLIAGGQFQDPLREGAHVMTGS
FT                   THKTLPGPQRGMILANPPGDEEKRDKFWKKIQRGVFPGVISNHHLHHMAALAITLAEHI
FT                   EFGKQYAEQVVKNAQTLAQELYELGFKVLGEKNGFTKSHTVLVDVVAQGGGRKVAEDLE
FT                   KANIICNYNLLPYDDPKKPRNPSGIRLGVQELTRLGMKENEMKYVAELIKRVAVDGDIE
FT                   GVKKDVKELKEEFNTIHYCFNEGVEAYKFLELVK"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /protein_id="YP_003482435.1"
FT   misc_feature    complement(60781..61998)
FT                   /note="Serine-glycine hydroxymethyltransferase (SHMT). This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). SHMT
FT                   carries out interconversion of serine and glycine; it
FT                   catalyzes the transfer of...; Region: SHMT; cd00378"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Aboo_0061"
FT   misc_feature    complement(order(61156..61158,61207..61209,61600..61605,
FT                   61714..61716,61735..61737,61780..61782,61804..61809,
FT                   61861..61863,61915..61917,61930..61932,61957..61962,
FT                   61981..61983,61987..61989))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Aboo_0061"
FT   misc_feature    complement(order(60907..60909,61312..61314,61330..61335,
FT                   61411..61413,61420..61422,61495..61497,61645..61647,
FT                   61726..61731,61828..61830,61858..61860,61918..61920))
FT                   /note="glycine-pyridoxal phosphate binding site; other
FT                   site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Aboo_0061"
FT   misc_feature    complement(order(60907..60909,61330..61332,61645..61647,
FT                   61918..61920))
FT                   /note="active site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Aboo_0061"
FT   misc_feature    complement(order(60958..60960,61231..61233,61642..61644,
FT                   61648..61650,61660..61662,61831..61833,61852..61854))
FT                   /note="folate binding site; other site"
FT                   /db_xref="CDD:99733"
FT                   /locus_tag="Aboo_0061"
FT   gene            complement(62033..62542)
FT                   /db_xref="GeneID:8826998"
FT                   /locus_tag="Aboo_0062"
FT   CDS_pept        complement(62033..62542)
FT                   /locus_tag="Aboo_0062"
FT                   /gene_family="HOG000063195" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /codon_start="1"
FT                   /product="intracellular protease, PfpI family"
FT                   /transl_table="11"
FT                   /note="KEGG: pfu:PF1719 intracellular protease; TIGRFAM:
FT                   intracellular protease, PfpI family; PFAM: ThiJ/PfpI domain
FT                   protein"
FT                   /db_xref="GI:289595740"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="GeneID:8826998"
FT                   /translation="MKGLILAENDFEDLELFYPYHRLREEGIEMLVASSQKELKGKRGY
FT                   SLKADIDYDEVNPDDFDILVIPGGKSPERVRLQKKAVDIVKHFFNENKPVAIICHGVQV
FT                   LISAGVVKGRKMACWYGVKDDLIVAGGEFVDGVSVDGNIVSARHPGDLAEWMKKFIELL
FT                   RNRKLL"
FT                   /protein_id="YP_003482436.1"
FT   misc_feature    complement(62057..62533)
FT                   /note="A type 1 glutamine amidotransferase (GATase1)-like
FT                   domain found in PfpI from Pyrococcus furiosus; Region:
FT                   GATase1_PfpI_like; cd03134"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Aboo_0062"
FT   misc_feature    complement(62243..62248)
FT                   /note="proposed catalytic triad; other site"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Aboo_0062"
FT   misc_feature    complement(62246..62248)
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Aboo_0062"
FT   gene            62628..63584
FT                   /db_xref="GeneID:8826999"
FT                   /locus_tag="Aboo_0063"
FT   CDS_pept        62628..63584
FT                   /locus_tag="Aboo_0063"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cfe:CF0363 biotin apo-protein ligase-related
FT                   protein"
FT                   /db_xref="GI:289595741"
FT                   /db_xref="GeneID:8826999"
FT                   /translation="MRKIGAIVLTILILSIAFFVFIVPLFNDYSTPPSFRITHMDGGLF
FT                   VRWYSKVPLIGKIELDGKNYTENCPVMLHKIFVPYFKRATHIRIVEMDRKIEVHSFCIN
FT                   IKNIKNSPIIIGLYNYSEIINISVISKLEFEEQNFKIEKIVSNNFSSIQKLCSYDAVVF
FT                   PNGDINHIMGSLTYPERENLVRYVREGGSFLGISAGASIISKYVIWKNKDYENCNFSLY
FT                   PGKLIGPLNSIEIFKNSTKIRRYTGFSSEINLTNASYFTYSGNISIIATYENPNRPAAI
FT                   KFNIDGGRVLLFGFDLCNIKNKKLSELISSEIEWLVL"
FT                   /protein_id="YP_003482437.1"
FT   misc_feature    <63087..>63227
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain; Region: GAT_1; cl00020"
FT                   /db_xref="CDD:173987"
FT                   /locus_tag="Aboo_0063"
FT   misc_feature    <63105..>63509
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG4285"
FT                   /db_xref="CDD:34007"
FT                   /locus_tag="Aboo_0063"
FT   gene            63642..65549
FT                   /db_xref="GeneID:8827000"
FT                   /locus_tag="Aboo_0064"
FT   CDS_pept        63642..65549
FT                   /locus_tag="Aboo_0064"
FT                   /gene_family="HOG000255839" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.7.2.3"
FT                   /codon_start="1"
FT                   /EC_number="1.7.2.3"
FT                   /transl_table="11"
FT                   /note="KEGG: pfu:PF1242 dehydrogenase subunit alpha; PFAM:
FT                   molydopterin dinucleotide-binding region; molybdopterin
FT                   oxidoreductase; molybdopterin oxidoreductase Fe4S4 region"
FT                   /db_xref="GI:289595742"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="GeneID:8827000"
FT                   /translation="MKFNVCMRDCYDTCSLISEMKDGKMRVRANPKNKVTSNFLCPKGA
FT                   LLPKWLYSKERVKTPLNRKGKKPSLSFNPTSWDNAMSIIAKKIKDTIKGYGESSVLLYY
FT                   YYGDRGFVNANFPHRLFNYINASIIEDTICDRSGEEALKDIYGTSQGMDPEELENENLI
FT                   VYWGINAAWTNIHGFYLTKRLGLDIWNVDVVKTKTAKMSNKFFMIKPETDVLFALGIAK
FT                   IIVDRNLYDEKFVETYTRGFEDFKEYLKSIDLNFVAEESGIDIEKIEDFAINYARERGI
FT                   VHIGYGFQRTINGGEAVRAISILPALIGKKRGFIYSNRILPRNYVRGISLRKKGGYRIT
FT                   HMELADYIEDEKIKFVFIYGTNPFATLPNQRKLRDAVLSSDVFIVLHDIFLTDTALFSD
FT                   IFLPSNTFFERVDIADSYYHRYISFNDKLTKISGKSNSDVARMLAKAMNLKEKTLYEKD
FT                   EEIIRKTLNVLGISYKRLKERGVLKIPIDSYEPKTESGKIEISSSRAKNRGLNAFPTYM
FT                   PIKGRGLKLISATYLFTISSQYYNTYGYVDTNIYLNPEDALDRGIKDGAKVRVFNEYGE
FT                   IITNAKISHDIQRGIALMYKAFWPMKIGWNANFLTPNKMNEKYGKGTTLHSVWVEVERI
FT                   "
FT                   /product="Trimethylamine-N-oxide reductase (cytochrome c)"
FT                   /protein_id="YP_003482438.1"
FT   misc_feature    63648..65186
FT                   /note="The MopB_3 CD includes a group of related
FT                   uncharacterized bacterial and archaeal
FT                   molybdopterin-binding oxidoreductase-like domains with a
FT                   putative N-terminal iron-sulfur [4Fe-4S] cluster binding
FT                   site and molybdopterin cofactor binding site. These...;
FT                   Region: MopB_3; cd02766"
FT                   /db_xref="CDD:73330"
FT                   /locus_tag="Aboo_0064"
FT   misc_feature    63657..65546
FT                   /note="Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing [Energy production and
FT                   conversion]; Region: BisC; COG0243"
FT                   /db_xref="CDD:30592"
FT                   /locus_tag="Aboo_0064"
FT   misc_feature    order(63657..63659,63669..63671,63681..63683,63762..63764)
FT                   /note="putative [4Fe-4S] binding site; other site"
FT                   /db_xref="CDD:73330"
FT                   /locus_tag="Aboo_0064"
FT   misc_feature    order(63768..63770,64032..64034,64038..64046,64137..64142,
FT                   64146..64148,64155..64160,64212..64220,64278..64280,
FT                   64494..64505,64596..64601,64719..64727,64800..64808,
FT                   64815..64817,64851..64856,64869..64871)
FT                   /note="putative molybdopterin cofactor binding site; other
FT                   site"
FT                   /db_xref="CDD:73330"
FT                   /locus_tag="Aboo_0064"
FT   misc_feature    65211..65543
FT                   /note="Molybdopterin-Binding, C-terminal (MopB_CT) domain
FT                   of the MopB superfamily of proteins, a  large, diverse,
FT                   heterogeneous superfamily of enzymes that, in general, bind
FT                   molybdopterin as a cofactor. The MopB domain is found in a
FT                   wide variety of molybdenum-; Region: MopB_CT; cl09929"
FT                   /db_xref="CDD:158784"
FT                   /locus_tag="Aboo_0064"
FT   misc_feature    order(65232..65237,65241..65252,65427..65429,65463..65465,
FT                   65514..65519)
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:30307"
FT                   /locus_tag="Aboo_0064"
FT   gene            complement(65546..67120)
FT                   /db_xref="GeneID:8827001"
FT                   /locus_tag="Aboo_0065"
FT   CDS_pept        complement(65546..67120)
FT                   /locus_tag="Aboo_0065"
FT                   /gene_family="HOG000222870" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /codon_start="1"
FT                   /product="Radical SAM domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mfe:Mefer_0266 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="GI:289595743"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="GeneID:8827001"
FT                   /translation="MTRIVLTADETLTSTYRHIPLLDFLGCAPVEHVPKPIYNFLDTQV
FT                   PDDNGKLTFAPYGLRKVEAALLHQGFNRDEIVVAHPRYVERFIDEKTTIVGVNTMDPYG
FT                   LGPVTMMFTQGGKLTSYTKLKFTSLMRRIRDYREKKGYKFKIEVGGPGSWQLEVKEKLT
FT                   EELRVDHIMIGETEHVIGDVFRDIESGNAEKIIHIKSWPKLEEIPNIVAPTFKGMIEVM
FT                   RGCGRGCTFCSPNLRTARFYPIEKILAELKVNIRAGQKTAWLHSEDIFNYMVEDRRNFY
FT                   PNEDAVIGLFEEVLKHVEFANPTHGTAAGGLAAPRILKRVAELNHANINRWVGIQVGFE
FT                   TASPELIKRIANNKMKPFSPEEWPWVLLNGTYAFNKFFWFPAYTSIVGLPGETDEDGYD
FT                   TARLIITMEKKLREKLGEKAHFTVTPLAFVPMAALKDEEGFNIQEQLTPGRVMHIYHAW
FT                   RHLAWEVDHGLKRVTRGNPAFLVFAPLAKMGSRLLVRSIRKWAMKNGIDVDKPLEPMKL
FT                   KIEEIDV"
FT                   /protein_id="YP_003482439.1"
FT   misc_feature    complement(65606..66961)
FT                   /note="Fe-S oxidoreductase [Energy production and
FT                   conversion]; Region: COG1032"
FT                   /db_xref="CDD:31235"
FT                   /locus_tag="Aboo_0065"
FT   misc_feature    complement(65909..66466)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cl14056"
FT                   /db_xref="CDD:176838"
FT                   /locus_tag="Aboo_0065"
FT   gene            complement(67092..67589)
FT                   /db_xref="GeneID:8827002"
FT                   /locus_tag="Aboo_0066"
FT   CDS_pept        complement(67092..67589)
FT                   /locus_tag="Aboo_0066"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pho:PH0825 hypothetical protein"
FT                   /db_xref="GI:289595744"
FT                   /db_xref="GeneID:8827002"
FT                   /translation="MKFEKDGFTKIRESMATIFTKAGLGHMDANVLSELLIWDRYMDVE
FT                   EIGRSLNYSISGVTGSLHRLMRMHLVIRKKMGKKYFYSSESDILSVFIRLVQEIYEHDL
FT                   PRLQRIVDEERELLKETEKNAVDELYVKLSRAKEYLGALIEILEDYKKGGELNDKNSAN
FT                   CG"
FT                   /protein_id="YP_003482440.1"
FT   misc_feature    complement(67131..67562)
FT                   /note="Predicted transcriptional regulators
FT                   [Transcription]; Region: COG1510"
FT                   /db_xref="CDD:31699"
FT                   /locus_tag="Aboo_0066"
FT   misc_feature    complement(<67341..67523)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Aboo_0066"
FT   gene            67685..68200
FT                   /db_xref="GeneID:8827003"
FT                   /locus_tag="Aboo_0067"
FT   CDS_pept        67685..68200
FT                   /locus_tag="Aboo_0067"
FT                   /gene_family="HOG000223755" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00279"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L10.e"
FT                   /transl_table="11"
FT                   /note="KEGG: mfe:Mefer_0789 ribosomal protein L10.e;
FT                   TIGRFAM: ribosomal protein L10.e; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="GI:289595745"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="GeneID:8827003"
FT                   /translation="MVRKPGRMYHNIDGPAYTRREYMGGVPNPKIVHFEMGNVDAKNDF
FT                   PIEVSLVINEACQIRHTALEAARIIANKYLGKIGTANYYLWIRVYPHHVLREHKMATGA
FT                   GADRISSGMSLAFGKPVGTAARVREGQVIMTARVNPQHLERAKKALKEASYKLPAPCSI
FT                   VVNKRSAN"
FT                   /protein_id="YP_003482441.1"
FT   misc_feature    67811..68176
FT                   /note="Ribosomal_L16_L10e: L16 is an essential protein in
FT                   the large ribosomal subunit of bacteria, mitochondria, and
FT                   chloroplasts. Large subunits that lack L16 are defective in
FT                   peptidyl transferase activity, peptidyl-tRNA hydrolysis
FT                   activity, association with...; Region: Ribosomal_L16_L10e;
FT                   cd01433"
FT                   /db_xref="CDD:88606"
FT                   /locus_tag="Aboo_0067"
FT   misc_feature    order(67811..67813,67820..67822,67868..67873,67880..67882,
FT                   67889..67891,67901..67903,67910..67912,67940..67948,
FT                   67952..67954,67958..67960,67970..67975,68021..68035,
FT                   68075..68077,68135..68140,68147..68152)
FT                   /note="23S rRNA interface; other site"
FT                   /db_xref="CDD:88606"
FT                   /locus_tag="Aboo_0067"
FT   misc_feature    67847..67852
FT                   /note="5S rRNA interface; other site"
FT                   /db_xref="CDD:88606"
FT                   /locus_tag="Aboo_0067"
FT   misc_feature    order(67883..67891,67898..67903)
FT                   /note="putative antibiotic binding site; other site"
FT                   /db_xref="CDD:88606"
FT                   /locus_tag="Aboo_0067"
FT   misc_feature    order(67910..67912,67931..67936,67940..67942,68093..68095)
FT                   /note="L25 interface; other site"
FT                   /db_xref="CDD:88606"
FT                   /locus_tag="Aboo_0067"
FT   misc_feature    order(68015..68020,68027..68032)
FT                   /note="L27 interface; other site"
FT                   /db_xref="CDD:88606"
FT                   /locus_tag="Aboo_0067"
FT   gene            complement(68197..68799)
FT                   /db_xref="GeneID:8827004"
FT                   /locus_tag="Aboo_0068"
FT   CDS_pept        complement(68197..68799)
FT                   /locus_tag="Aboo_0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05763"
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF835"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF835; KEGG:
FT                   mtp:Mthe_0715 Na+/solute symporter"
FT                   /db_xref="GI:289595746"
FT                   /db_xref="InterPro:IPR008553"
FT                   /db_xref="GeneID:8827004"
FT                   /translation="MKFNFMPSVEELIRELRMALKKDDDELRKEVERIVRKYGRRRKKG
FT                   SFEMKAGEAYYINEKNSKYAIKIFQQILDRGLNGLYITRINPQTLEFANQDNAKVVWLS
FT                   SIRGKDRISPGDLTKIHATVVEFMKENEKGVVVLDGIETMITNTNFVKVLHLLQKLRDV
FT                   VSENHGVLLISIDLDTLNPQDRALFKREIMNEIPLKI"
FT                   /protein_id="YP_003482442.1"
FT   misc_feature    complement(68227..68640)
FT                   /note="Protein of unknown function (DUF835); Region:
FT                   DUF835; pfam05763"
FT                   /db_xref="CDD:114486"
FT                   /locus_tag="Aboo_0068"
FT   gene            complement(68819..69886)
FT                   /db_xref="GeneID:8827005"
FT                   /locus_tag="Aboo_0069"
FT   CDS_pept        complement(68819..69886)
FT                   /locus_tag="Aboo_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /codon_start="1"
FT                   /product="Fmu (Sun) domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG:
FT                   bac:BamMC406_2427 Fmu (Sun) domain-containing protein"
FT                   /db_xref="GI:289595747"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="GeneID:8827005"
FT                   /translation="MIEKIAVRVIRKWMRKGNMARAMRDILPRSSLSFEEREQVARIVH
FT                   DVVRYKLYYDYIMEKRGMKKNAENYVKLSLKKPKVNTPYHIRNSLSLKLAEVTPREFID
FT                   IINREPDTVLCVNLAKIDRDKAIEELERDGIDAEEFIPESAIKADSKARYSSLIKNGLA
FT                   IVQDSSSQIIAKLASSLGEEVLDYCAGSGGKSLAMHALNSNLKIHAYDINERKLKSLEN
FT                   RAKKWEMNVYIFYDKPSGEFPVVLVDAPCSGVGAAARNPEAKYQEDFEKFAKMQMEILN
FT                   EAKENVKSHGYLVYVVCSYTPWETENLIEEFLNKAPYFVPQEIKCEYERYIKKGNYGAY
FT                   ILAGDIFYVSVLRRE"
FT                   /protein_id="YP_003482443.1"
FT   misc_feature    complement(68936..69541)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Aboo_0069"
FT   gene            70178..70606
FT                   /db_xref="GeneID:8827006"
FT                   /locus_tag="Aboo_0070"
FT   CDS_pept        70178..70606
FT                   /locus_tag="Aboo_0070"
FT                   /gene_family="HOG000040064" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00982"
FT                   /codon_start="1"
FT                   /product="ribosomal protein S23 (S12)"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0853 30S ribosomal protein S12P;
FT                   TIGRFAM: ribosomal protein S23 (S12); PFAM: ribosomal
FT                   protein S12/S23"
FT                   /db_xref="GI:289595748"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="GeneID:8827006"
FT                   /translation="MANGLYTARKLKEDREKFRWSDRYYKRRVLRLKEKSDPLEGSPQA
FT                   RGIVIEKVGIEAKQPNSAIRKCVKVQLIKNGRVVTAFAPGNGAINFIDEHDEVVIEGIG
FT                   GRLGRSKGDIPGVRYKVIKVNGISLNELVRGRKEKPVR"
FT                   /protein_id="YP_003482444.1"
FT   misc_feature    70250..70594
FT                   /note="S12-like family, 40S ribosomal protein S23
FT                   subfamily; S23 is located at the interface of the large and
FT                   small ribosomal subunits of eukaryotes, adjacent to the
FT                   decoding center. It interacts with domain III of the
FT                   eukaryotic elongation factor 2 (eEF2)...; Region:
FT                   Ribosomal_S23; cd03367"
FT                   /db_xref="CDD:48340"
FT                   /locus_tag="Aboo_0070"
FT   misc_feature    order(70253..70267,70271..70273,70277..70294,70298..70318,
FT                   70349..70375,70391..70399,70421..70423,70427..70438,
FT                   70475..70495,70505..70516,70532..70537,70550..70552,
FT                   70556..70558,70586..70594)
FT                   /note="18S rRNA interaction site; other site"
FT                   /db_xref="CDD:48340"
FT                   /locus_tag="Aboo_0070"
FT   misc_feature    order(70349..70354,70508..70510)
FT                   /note="streptomycin interaction site; other site"
FT                   /db_xref="CDD:48340"
FT                   /locus_tag="Aboo_0070"
FT   misc_feature    70352..70357
FT                   /note="28S rRNA interaction site; other site"
FT                   /db_xref="CDD:48340"
FT                   /locus_tag="Aboo_0070"
FT   misc_feature    order(70355..70372,70433..70459)
FT                   /note="aminoacyl-tRNA interaction site (A-site); other
FT                   site"
FT                   /db_xref="CDD:48340"
FT                   /locus_tag="Aboo_0070"
FT   misc_feature    70460..70462
FT                   /note="eEF2 interaction site; other site"
FT                   /db_xref="CDD:48340"
FT                   /locus_tag="Aboo_0070"
FT   gene            70612..71175
FT                   /db_xref="GeneID:8827007"
FT                   /locus_tag="Aboo_0071"
FT   CDS_pept        70612..71175
FT                   /locus_tag="Aboo_0071"
FT                   /gene_family="HOG000039066" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01028"
FT                   /codon_start="1"
FT                   /product="ribosomal protein S7"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0854 30S ribosomal protein S7P;
FT                   TIGRFAM: ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="GI:289595749"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="GeneID:8827007"
FT                   /translation="MDFLIFGKYDPKEVVVKDPGLVRYINLDARLVLHSHGRHVKKHLG
FT                   KAQVNIVERLINNLMRTEKYTGKKMSAYNVVKKAFEIIEKKTKQNPIQVLVDAIQNAAP
FT                   REEVTRLKMAGIAVPKAVDVAPSRRLDIALRNIALGAVNSTFKNSKSIEECLADEIIKA
FT                   ARNDVSSFAVSKKEEIERVAASAR"
FT                   /protein_id="YP_003482445.1"
FT   misc_feature    70612..71172
FT                   /note="Ribosomal protein S7p/S5e; Region: Ribosomal_S7;
FT                   cl00313"
FT                   /db_xref="CDD:174102"
FT                   /locus_tag="Aboo_0071"
FT   gene            71186..73390
FT                   /db_xref="GeneID:8827008"
FT                   /locus_tag="Aboo_0072"
FT   CDS_pept        71186..73390
FT                   /locus_tag="Aboo_0072"
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00490"
FT                   /codon_start="1"
FT                   /product="translation elongation factor aEF-2"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0417 elongation factor EF-2; TIGRFAM:
FT                   translation elongation factor aEF-2; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain IV; elongation factor G domain protein"
FT                   /db_xref="GI:289595750"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="GeneID:8827008"
FT                   /translation="MGRKEDNIKKAMKIMRNIEYIRNIGIVAHIDHGKTTLSDNLIAGA
FT                   GMMSEELAGKQLVLDFDEQEQARGITINTAAASMVHEYEGNEYLINLLDTPGHVDFGGD
FT                   VTRAMRAVDGAIVVVCAVEGVMPQTETVLRQALKERVRPVLFINKVDRLINELKLDGQQ
FT                   MMARFEKIIKEVNKLIRRYTPEEFKDKWMVRVEDGTVAFGSAYHNWAISVPFMKKTGIS
FT                   FKDVFEHLEKGESKELAKKAPLHRIVLDMVIQHLPNPREAQAYRIPKIWKGDINTPLGQ
FT                   AMIKCDPKGPVGMMITKIVMDPHAGEVAVGRLFSGTLRRGQELYIVGMGNRKYRIQQLS
FT                   MMVGPDRIPVDELDAGNIPAIIGLKDAIAGSTVSSIPDVEPFEPMKHYSEPVVTVAIEA
FT                   KHTKDLPRLIEVLRTISKADPSLKIEINQETGEHLLSGMGELHLEVTIYRITHEYKVEV
FT                   ITSPPIVVYRETVDHKGGPFEGKSPNKHNKFYIEVEPLEESVVQAIVDGEIEEMDRIKN
FT                   RKDLAKRLEELGMNRDEAKKVEAIRGPNILLDMTWGVQYLNETMELVKQAFFEAVERGP
FT                   LANEKVYGLKVKLVDAKLHEDSIHRGPAQVIPAVRNAIYGAMCQGNRVLLEPIQKIYIN
FT                   VPMELVGSVTREIQQRRGVIVDMEQEEYQTIIHAKAPVAEMFGFASAIRSATGGRVLWS
FT                   TENAGYERVPRDLQPQIVRQIRERKGLKPEPYDEKYYAEL"
FT                   /protein_id="YP_003482446.1"
FT   misc_feature    71189..73387
FT                   /note="elongation factor EF-2; Reviewed; Region: PRK07560"
FT                   /db_xref="CDD:169006"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    71249..71962
FT                   /note="EF2 (for archaea and eukarya).  Translocation
FT                   requires hydrolysis of a molecule of GTP and is mediated by
FT                   EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic
FT                   elongation factor eEF2 is a GTPase involved in the
FT                   translocation of the peptidyl-tRNA...; Region: EF2;
FT                   cd01885"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    71267..71290
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    order(71270..71272,71276..71278,71288..71293,71300..71302,
FT                   71309..71314,71408..71413,71477..71482,71549..71554,
FT                   71681..71683,71693..71695)
FT                   /note="putative GEF interaction site; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    order(71276..71293,71627..71632,71636..71638,71795..71803)
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    71351..71410
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    71396..71398
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    71465..71476
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    71471..71527
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    71627..71638
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    71795..71803
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133285"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    72065..72310
FT                   /note="EF2_snRNP_like_II: this subfamily represents domain
FT                   II of elongation factor (EF) EF-2 found eukaryotes and
FT                   archaea and, the C-terminal portion of the spliceosomal
FT                   human 116kD U5 small nuclear ribonucleoprotein (snRNP)
FT                   protein (U5-116 kD) and, its yeast...; Region:
FT                   eEF2_snRNP_like_II; cd03700"
FT                   /db_xref="CDD:58091"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    72569..73078
FT                   /note="This family represents domain IV of archaeal and
FT                   eukaryotic elongation factor 2 (aeEF-2) and of an
FT                   evolutionarily conserved U5 snRNP-specific protein. U5
FT                   snRNP is a GTP-binding factor closely related to the
FT                   ribosomal translocase EF-2. In complex with...; Region:
FT                   aeEF2_snRNP_like_IV; cd01681"
FT                   /db_xref="CDD:58276"
FT                   /locus_tag="Aboo_0072"
FT   misc_feature    73064..73297
FT                   /note="Elongation factor G C-terminus. This domain includes
FT                   the carboxyl terminal regions of elongation factors (EFs)
FT                   bacterial EF-G, eukaryotic and archeal EF-2 and eukaryotic
FT                   mitochondrial mtEFG1s and mtEFG2s. This group also includes
FT                   proteins similar to...; Region: Elongation_Factor_C;
FT                   cd01514"
FT                   /db_xref="CDD:58061"
FT                   /locus_tag="Aboo_0072"
FT   gene            73444..74718
FT                   /db_xref="GeneID:8827009"
FT                   /locus_tag="Aboo_0073"
FT   CDS_pept        73444..74718
FT                   /locus_tag="Aboo_0073"
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00483"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.4"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: translation elongation factor EF-1, subunit
FT                   alpha; small GTP-binding protein; KEGG: tac:Ta0444
FT                   elongation factor 1-alpha; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor Tu domain protein"
FT                   /db_xref="GI:289595751"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="GeneID:8827009"
FT                   /translation="MADKKPHMNIVFIGHVDHGKSTTVGRLLYEHGEIDQRVIDQYRQE
FT                   AEKLGKSTFEFAFVMDRLKEERERGLTIDVAHRKFETDKYYFTIIDAPGHRDFVKNMIT
FT                   GTSQADAAVLIVAAPEGVMEQTKEHIFLARTLGVPQMIVAINKMDATKPPYDEKRFNEV
FT                   KEQVEKLLAAVGWKDVPFVPISAYKGDNIMKKSENMPWWKGPTLLELLNNLKVPPKPTD
FT                   KPLRIPVQDVYSITGIGTVPVGRVETGVLKVGDKVTFMPANKSGEVKSIEMHHEPMKEA
FT                   YPGDNIGFNVRGIGKKDIKRGDVCGHTSNPPTVAKSFIAQIVVLNHPSVIAPGYTPVFH
FT                   AHTAQIACRFEELIKTLDPRTGQTKQDHPDFLKTGDIAMVKIVPTRPMVIEPVKEIPQL
FT                   GRFAVRDMGQTVAAGQCIEVEKKTL"
FT                   /product="translation elongation factor EF-1, subunit
FT                   alpha"
FT                   /protein_id="YP_003482447.1"
FT   misc_feature    73444..74709
FT                   /note="elongation factor 1-alpha; Reviewed; Region:
FT                   PRK12317"
FT                   /db_xref="CDD:171398"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    73468..74097
FT                   /note="Eukaryotic elongation factor 1 (EF1) alpha
FT                   subfamily.  EF1 is responsible for the GTP-dependent
FT                   binding of aminoacyl-tRNAs to the ribosomes.  EF1 is
FT                   composed of four subunits: the alpha chain which binds GTP
FT                   and aminoacyl-tRNAs, the gamma chain that...; Region:
FT                   EF1_alpha; cd01883"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    73483..73506
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    order(73486..73488,73492..73494,73504..73509,73516..73518,
FT                   73525..73530,73669..73674,73726..73731,73798..73803,
FT                   73927..73929,73939..73941)
FT                   /note="putative GEF interaction site; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    order(73492..73494,73498..73509,73879..73884,73888..73890,
FT                   73996..74004)
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    order(73504..73506,73633..73635,73642..73647,73651..73653,
FT                   73657..73659,73663..73671,73675..73677,73708..73710,
FT                   73714..73716,73720..73728,73732..73734,73741..73743)
FT                   /note="EF1Balpha binding site; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    73639..73671
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    73657..73659
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    73714..73725
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    73720..73776
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    73879..73890
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    73996..74004
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133283"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    74104..74376
FT                   /note="EF1_alpha_II: this family represents the domain II
FT                   of elongation factor 1-alpha (EF-1a) that is found in
FT                   archaea and all eukaryotic lineages. EF-1A is very abundant
FT                   in the cytosol, where it is involved in the GTP-dependent
FT                   binding of aminoacyl-tRNAs to...; Region: EF1_alpha_II;
FT                   cd03693"
FT                   /db_xref="CDD:58084"
FT                   /locus_tag="Aboo_0073"
FT   misc_feature    74380..74691
FT                   /note="Domain III of EF-1. Eukaryotic elongation factor 1
FT                   (EF-1) is responsible for the GTP-dependent binding of
FT                   aminoacyl-tRNAs to ribosomes. EF-1 is composed of four
FT                   subunits: the alpha chain, which binds GTP and
FT                   aminoacyl-tRNAs, the gamma chain that...; Region:
FT                   EF1_alpha_III; cd03705"
FT                   /db_xref="CDD:58071"
FT                   /locus_tag="Aboo_0073"
FT   gene            74742..75056
FT                   /db_xref="GeneID:8827010"
FT                   /locus_tag="Aboo_0074"
FT   CDS_pept        74742..75056
FT                   /locus_tag="Aboo_0074"
FT                   /gene_family="HOG000270244" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01046"
FT                   /codon_start="1"
FT                   /product="ribosomal protein S10"
FT                   /transl_table="11"
FT                   /note="KEGG: tac:Ta0445 30S ribosomal protein S10P;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="GI:289595752"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="GeneID:8827010"
FT                   /translation="MAVYRARIRLSGADHKKVDEVCNQIKKIAERTGVELHGPIPLPTK
FT                   RLVVPVRKAPDGEGSETWERWEMRIHKRLIDIDADERALRQLMRIQIPDGIHIEIELKS
FT                   "
FT                   /protein_id="YP_003482448.1"
FT   misc_feature    74748..75053
FT                   /note="Ribosomal protein S10p/S20e; Region: Ribosomal_S10;
FT                   cl00314"
FT                   /db_xref="CDD:174103"
FT                   /locus_tag="Aboo_0074"
FT   gene            complement(75053..75850)
FT                   /db_xref="GeneID:8827011"
FT                   /locus_tag="Aboo_0075"
FT   CDS_pept        complement(75053..75850)
FT                   /locus_tag="Aboo_0075"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF147"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF147; KEGG:
FT                   ton:TON_0660 hypothetical protein"
FT                   /db_xref="GI:289595753"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="GeneID:8827011"
FT                   /translation="MDEPTKIVVMGDDPESIAQNYEDKELIVIYPKGKRPRADMLLRKN
FT                   IVRIFSDYGKYPDIEDLELIKNTVFYLLNSSYINNRDRILLLFSKEGEEHRLFFDMSKM
FT                   NLPNLVNMVSDRIKGEIVENILKLAMSIVKKGREGTPAGALFIVGDTNNVKNYVIQKIA
FT                   NPISGIDREMRSVLNEENFDTLREFAIMDGATLIDNRGVVVSTGVYVKNLSIEEWLMDG
FT                   FGGRHLAARSITKLTKAISFAVSAEGTISVYRDGEKIYELKDF"
FT                   /protein_id="YP_003482449.1"
FT   misc_feature    complement(75077..75448)
FT                   /note="DisA bacterial checkpoint controller
FT                   nucleotide-binding; Region: DisA_N; pfam02457"
FT                   /db_xref="CDD:145543"
FT                   /locus_tag="Aboo_0075"
FT   gene            complement(75875..76486)
FT                   /db_xref="GeneID:8827012"
FT                   /locus_tag="Aboo_0076"
FT   CDS_pept        complement(75875..76486)
FT                   /locus_tag="Aboo_0076"
FT                   /gene_family="HOG000224719" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01997"
FT                   /codon_start="1"
FT                   /product="Translin"
FT                   /transl_table="11"
FT                   /note="PFAM: Translin; KEGG: mtp:Mthe_0362 translin family
FT                   protein"
FT                   /db_xref="GI:289595754"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="GeneID:8827012"
FT                   /translation="MDLREIGDLIEEELDEKDSVREIAIKSARVIIRMSSQSIIMMHRR
FT                   EDESEIVRKLKEEVWHLKSLLTNQYPDLLYSGFVQNAFQEYCESQIFRAIIHNKPIPSH
FT                   KDLGMNPESYLMGMGDVVGELRREVLEALKNENFKRAEEYLSIMEEIYEMLMRFNYPSG
FT                   LVPLKPKQDTARALIEKTRGELTMAIMTDKIAKKMENKKN"
FT                   /protein_id="YP_003482450.1"
FT   misc_feature    complement(75878..76438)
FT                   /note="Translin family; Region: Translin; cl00957"
FT                   /db_xref="CDD:174480"
FT                   /locus_tag="Aboo_0076"
FT   gene            complement(76513..76884)
FT                   /db_xref="GeneID:8827013"
FT                   /locus_tag="Aboo_0077"
FT   CDS_pept        complement(76513..76884)
FT                   /locus_tag="Aboo_0077"
FT                   /gene_family="HOG000226985" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ta0623"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tac:Ta0623 hypothetical protein"
FT                   /db_xref="GI:289595755"
FT                   /db_xref="GeneID:8827013"
FT                   /translation="MNKVWKIKKEVLKLIMESSKSSYPNEFGAFLRAKHNIIYEIILLP
FT                   GTVSGGSSVLYNLLMKPIDFTIVGSVHSHPSGFPIPSRADLDMFSKTGDVHIIVAYPYT
FT                   MNSWKAYNRMGEEIEVKVI"
FT                   /protein_id="YP_003482451.1"
FT   misc_feature    complement(76516..76866)
FT                   /note="Mov34/MPN/PAD-1 family: archaeal JAB1/MPN/Mov34
FT                   metalloenzyme; Region: MPN_archaeal; cd08072"
FT                   /db_xref="CDD:163703"
FT                   /locus_tag="Aboo_0077"
FT   misc_feature    complement(order(76630..76632,76639..76641,76663..76665,
FT                   76669..76671,76807..76809))
FT                   /note="MPN+ (JAMM) motif; other site"
FT                   /db_xref="CDD:163703"
FT                   /locus_tag="Aboo_0077"
FT   misc_feature    complement(order(76630..76632,76663..76665,76669..76671))
FT                   /note="Zinc-binding site; other site"
FT                   /db_xref="CDD:163703"
FT                   /locus_tag="Aboo_0077"
FT   gene            complement(76881..77669)
FT                   /db_xref="GeneID:8827014"
FT                   /locus_tag="Aboo_0078"
FT   CDS_pept        complement(76881..77669)
FT                   /locus_tag="Aboo_0078"
FT                   /gene_family="HOG000227222" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /codon_start="1"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: tvo:TVN1034
FT                   inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="GI:289595756"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="GeneID:8827014"
FT                   /translation="MRYGLIANPEKEECIKFAKEIIEKLDPVVEMETAKALGMDGISIE
FT                   EMNVDVIITVGGDGTILLALQRARGRILGVNMGLLGFLTEISPEELDDAIKRIESGDYF
FT                   IDKRMRIKVRLNGERLYDCTNEVVIHTAEIAKLRSYTIFYEKELLDEFRADGLIVATPT
FT                   GSTSYALSAGGPILHPNLEGMVLTPIAPFKKYPKSFVLPEGKIRIELKDGRSNLLVLDG
FT                   QYSVRISKKDIVEIEKSENYAEFIRFSNSPIKRIRERLIG"
FT                   /protein_id="YP_003482452.1"
FT   misc_feature    complement(76887..77669)
FT                   /note="Diacylglycerol kinase catalytic domain; Region:
FT                   DAGK_cat; cl01255"
FT                   /db_xref="CDD:174600"
FT                   /locus_tag="Aboo_0078"
FT   misc_feature    complement(76926..77666)
FT                   /note="ATP-NAD kinase; Region: NAD_kinase; pfam01513"
FT                   /db_xref="CDD:144927"
FT                   /locus_tag="Aboo_0078"
FT   gene            complement(77666..78442)
FT                   /db_xref="GeneID:8827015"
FT                   /locus_tag="Aboo_0079"
FT   CDS_pept        complement(77666..78442)
FT                   /locus_tag="Aboo_0079"
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.1.3.25"
FT                   /codon_start="1"
FT                   /EC_number="3.1.3.25"
FT                   /transl_table="11"
FT                   /note="KEGG: mac:MA3344 bifunctional inositol-1
FT                   monophosphatase/fructose-1,6-bisphosphatase; PFAM: inositol
FT                   monophosphatase"
FT                   /db_xref="GI:289595757"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="GeneID:8827015"
FT                   /translation="MKEDMENIKRLANGARKEILLILEEYGEKASKTVQMGAYGAPSSL
FT                   VDVEAENKIIQMVKEEDMPYNIFTEEAGFIDRGYDRTIIVDPLDGSYNAENGIPFYAVS
FT                   IAIGKKNLQDVEYGIVKNVPLNVDYWAIKGEGAYKNGKKLKVDGKKNLYVVYLGKKAHK
FT                   QSFELAQKIRRTRTLGSAALEMCMVAEGIADMFIYKFKEKGYLRIVDIAAAYLIVKESG
FT                   GIVVDGILKPLDMDILGMERKNVIAAANPQLLEVFR"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /protein_id="YP_003482453.1"
FT   misc_feature    complement(77672..78361)
FT                   /note="FIG, FBPase/IMPase/glpX-like domain. A superfamily
FT                   of metal-dependent phosphatases with various substrates.
FT                   Fructose-1,6-bisphospatase (both the major and the
FT                   glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate
FT                   to fructose-6-phosphate in...; Region: FIG; cl00289"
FT                   /db_xref="CDD:174091"
FT                   /locus_tag="Aboo_0079"
FT   misc_feature    complement(order(77813..77815,78173..78187,78230..78235,
FT                   78302..78304))
FT                   /note="active site"
FT                   /db_xref="CDD:73280"
FT                   /locus_tag="Aboo_0079"
FT   gene            complement(78489..79754)
FT                   /db_xref="GeneID:8827016"
FT                   /locus_tag="Aboo_0080"
FT   CDS_pept        complement(78489..79754)
FT                   /locus_tag="Aboo_0080"
FT                   /gene_family="HOG000004885" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00374"
FT                   /codon_start="1"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: kcr:Kcr_0321 coenzyme F420-reducing hydrogenase,
FT                   alpha subunit"
FT                   /db_xref="GI:289595758"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="GeneID:8827016"
FT                   /translation="MVERRIRIEEITKIEGHANLTIEIEDENLKRVIFGVHEGSRYFEA
FT                   FMVGKSYKYLPELAGRICGICTVAHEIASVRAVEDALGIEISEEVEDLRKLMLISSHIQ
FT                   SHILHLYFLALPDYRNVESIIELANKNVNLVKKAFELKEASNYMTELIGGRAVQPCTIV
FT                   PGKVSKRIGKETIERYIKKMKDIYPFLLDTAELFLSLEYPKYERESEYVALWDGHSIPL
FT                   YKGEIATLSSIFDPHQYQEHIREWVVEYSSAKHSLIDGRDYMVGALARLNINRNLREEA
FT                   RELAERYGVRFPSNRIAWINLAQALENVYFALEAIEIAENLKEYDPHKINIPRVSGEGV
FT                   GVIEAPRGLLIHHYKIKNGKCTYVNIITPTAMNTENVERNLKGYISQIVSKNDEYIKME
FT                   AEKIIRAYDPCISCSVHVTRIM"
FT                   /protein_id="YP_003482454.1"
FT   misc_feature    complement(78492..79721)
FT                   /note="Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   Region: Complex1_49kDa; cl00417"
FT                   /db_xref="CDD:174191"
FT                   /locus_tag="Aboo_0080"
FT   gene            complement(79736..80482)
FT                   /db_xref="GeneID:8827017"
FT                   /locus_tag="Aboo_0081"
FT   CDS_pept        complement(79736..80482)
FT                   /locus_tag="Aboo_0081"
FT                   /gene_family="HOG000004874" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /codon_start="1"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: cpc:Cpar_0318 NADH ubiquinone oxidoreductase 20 kDa
FT                   subunit"
FT                   /db_xref="GI:289595759"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="GeneID:8827017"
FT                   /translation="MNIGIISLSCCEGCSVQFLNMEKEILEILKYMGINNFRLAKEINE
FT                   WPVEIAFVEGTPTNRDEIIKLLKIRKDSKILVALGTCAATGGVPAIVNTLEKKEAMKIY
FT                   NGVPPKIPIDAKPLKYYVDVDYILYGCPFSKEELKELITSVLLGKGFRNKRYSVCVECT
FT                   LRENGCLLEEGYLCMGPVTRAGCKAICPSNNTQCLGCRGPYEDANFKGHIRILLEMGFS
FT                   KDEIAEAYSIFSYEELKEVIAWLKEE"
FT                   /protein_id="YP_003482455.1"
FT   misc_feature    complement(80048..80452)
FT                   /note="NADH ubiquinone oxidoreductase, 20 Kd subunit;
FT                   Region: Oxidored_q6; cl00419"
FT                   /db_xref="CDD:174193"
FT                   /locus_tag="Aboo_0081"
FT   gene            complement(80479..81291)
FT                   /db_xref="GeneID:8827018"
FT                   /locus_tag="Aboo_0082"
FT   CDS_pept        complement(80479..81291)
FT                   /locus_tag="Aboo_0082"
FT                   /gene_family="HOG000225119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /codon_start="1"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulphur cluster binding domain;
FT                   Oxidoreductase FAD-binding domain protein; KEGG:
FT                   rmr:Rmar_2588 oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="GI:289595760"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="GeneID:8827018"
FT                   /translation="MNPYIPSVAPILEVRDETPDTKTFRIGAELPFKPGQFVELSVFGY
FT                   GEAPISISGGDDEAIELTIRAVGNVTKKIHRMKEGDYVGIRGPFGNGWPIEKAVDKNIL
FT                   IIAGGIGLAPLKPVVEYVCKHRERFKDATLLYGARRPSLMLFKYKFEEWRKYMDILLTV
FT                   DEAEPGWEGHVGVVTTLCDKIRHVADTITYMCGPPIMMKYTSMVLIELGFPPSEMYLSL
FT                   ERNMKCGIGICGHCGVGGVYVCRDGPVFSLNKALRFIEKPHEVQGVLD"
FT                   /protein_id="YP_003482456.1"
FT   misc_feature    complement(80512..81291)
FT                   /note="anaerobic sulfite reductase subunit B; Provisional;
FT                   Region: PRK08221"
FT                   /db_xref="CDD:169290"
FT                   /locus_tag="Aboo_0082"
FT   misc_feature    complement(80536..81261)
FT                   /note="Anaerobic sulfite reductase contains an FAD and
FT                   NADPH binding module with structural similarity to
FT                   ferredoxin reductase and sequence similarity to
FT                   dihydroorotate dehydrogenases. Clostridium pasteurianum
FT                   inducible dissimilatory type sulfite reductase is...;
FT                   Region: sulfite_reductase_like; cd06221"
FT                   /db_xref="CDD:99817"
FT                   /locus_tag="Aboo_0082"
FT   misc_feature    complement(order(80617..80622,80962..80964,81079..81087,
FT                   81097..81105,81139..81150,81154..81156))
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99817"
FT                   /locus_tag="Aboo_0082"
FT   misc_feature    complement(order(81139..81144,81148..81150))
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99817"
FT                   /locus_tag="Aboo_0082"
FT   misc_feature    complement(order(81022..81024,81028..81030,81052..81054,
FT                   81070..81072,81079..81081,81088..81090))
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99817"
FT                   /locus_tag="Aboo_0082"
FT   misc_feature    complement(order(80950..80952,80956..80967,80977..80979))
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99817"
FT                   /locus_tag="Aboo_0082"
FT   misc_feature    complement(order(80701..80706,80875..80883,80959..80964))
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99817"
FT                   /locus_tag="Aboo_0082"
FT   misc_feature    complement(order(80560..80562,80584..80586,80593..80595,
FT                   80608..80610))
FT                   /note="Iron coordination center; other site"
FT                   /db_xref="CDD:99817"
FT                   /locus_tag="Aboo_0082"
FT   gene            complement(81288..82307)
FT                   /db_xref="GeneID:8827019"
FT                   /locus_tag="Aboo_0083"
FT   CDS_pept        complement(81288..82307)
FT                   /locus_tag="Aboo_0083"
FT                   /gene_family="HOG000227558" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Adeg_1330"
FT                   /codon_start="1"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: adg:Adeg_1330 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="GI:289595761"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:8827019"
FT                   /translation="MSVKIAKTKINEFLTWIMDNYALYAPVEDGVTKFCRIENLSKICF
FT                   FPNRTDVSLKPIFFPPEQKFFKWEKGDNGYIIRDYLDKGEKKVIFGARGCDVHALKILD
FT                   MYMSGEFSDPYYSKRRENTIIIGITCDYPRDSCFCTAFGGMVPEEYDLWLTDIGTHYFV
FT                   DIGSENGRKLISLDIFEDADEEDEIRKRRKIERVEYEVEKRTKIDLCEIKRCSQEIKKK
FT                   INDEIWDELGKICVSCGRCNFICPTCHCFDVRDITNLDGSEGERIRVWDSCHLYEYAKT
FT                   SAENFRKERHARVRYRVYDKFVFPVMRYGVYACTGCGRCTDACHAGINIREVLRRLIE"
FT                   /protein_id="YP_003482457.1"
FT   misc_feature    complement(81297..82307)
FT                   /note="sulfite reductase, subunit A; Region: sulfite_red_A;
FT                   TIGR02910"
FT                   /db_xref="CDD:131956"
FT                   /locus_tag="Aboo_0083"
FT   gene            complement(82460..83890)
FT                   /db_xref="GeneID:8827020"
FT                   /locus_tag="Aboo_0084"
FT   CDS_pept        complement(82460..83890)
FT                   /locus_tag="Aboo_0084"
FT                   /gene_family="HOG000031439" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01316"
FT                   /codon_start="1"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /transl_table="11"
FT                   /note="KEGG: kcr:Kcr_0346 glutamate synthase (NADPH),
FT                   homotetrameric; TIGRFAM: glutamate synthase (NADPH),
FT                   homotetrameric; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="GI:289595762"
FT                   /db_xref="InterPro:IPR000759"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:8827020"
FT                   /translation="MAKQIKKKRIAVPEQDPQARIHNFNEVALGYTFELAKEEASRCIQ
FT                   CPYNFAPCIKGCPVNVNIPGFIKKILENDMKGALEVIHETNSLPGITGRVCPQEEQCEM
FT                   NCVMGKLGDKINIGKLERFVADYAREHGIMPETKIAPKNGKKVAIVGSGPSGLTAASDL
FT                   IKMGYDVTVYEALHEPGGVLIYGIPEFRLPKDIVEYEVKYLKMLGAKIETNVVIGKTLS
FT                   LYDLAKEYDAVFLGTGAGTPKFLNLPGVNCKGIYSANEFLTRINLMKAYKFPEYDTPIK
FT                   VGKRLAVIGAGNVAMDAARSALRVGFEEVYILYRRTREYMTAREEEIQHAEEEGVKFMF
FT                   LVSPVEFIGDDNCNVKVVKLIMNKLGEPDSSGRRRPEPIPGTEFALEVDAVVFAIGQKP
FT                   NKVLYQEVPELKTTKWGTLIVDEKYRTTMRGVFAGGDAVRGEATVVLAMGDGKRAAKAI
FT                   DEYIRTGEWPEEINQKTF"
FT                   /protein_id="YP_003482458.1"
FT   misc_feature    complement(82502..83884)
FT                   /note="putative oxidoreductase; Provisional; Region:
FT                   PRK12831"
FT                   /db_xref="CDD:171756"
FT                   /locus_tag="Aboo_0084"
FT   misc_feature    complement(<83348..83455)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Aboo_0084"
FT   gene            complement(83892..84722)
FT                   /db_xref="GeneID:8827021"
FT                   /locus_tag="Aboo_0085"
FT   CDS_pept        complement(83892..84722)
FT                   /locus_tag="Aboo_0085"
FT                   /gene_family="HOG000225117" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /codon_start="1"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulphur cluster binding domain; KEGG:
FT                   kcr:Kcr_0345 ferredoxin-NADP(+) reductase subunit alpha"
FT                   /db_xref="GI:289595763"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="GeneID:8827021"
FT                   /translation="MFEIVDKKVLAPNIKWIRVKAPLVTKNAKAGQFIVLRLHEKGERI
FT                   PLTLFKWHKEDGTIELVFQEVGKTTYELGSYEPGDKIMDIVGPLGKPTHIENYGTAVVV
FT                   SGGVGAPIGYAVTRALKEAGNHVVSIIGFRNKQYVILEDEFKKVSDELLITTDDGSYVR
FT                   KGFTTDVLKEYLANGGKADYVFTVGPVIMMKLIADITKEHGIKTDASLNPIMVDGTGMC
FT                   GACRVTVGGEIKFACVDGPDFDAHQVNFDELLTRLTEYREEERIAMDRYVKGVH"
FT                   /protein_id="YP_003482459.1"
FT   misc_feature    complement(83895..84722)
FT                   /note="ferredoxin-NADP(+) reductase subunit alpha;
FT                   Reviewed; Region: PRK06222"
FT                   /db_xref="CDD:168473"
FT                   /locus_tag="Aboo_0085"
FT   misc_feature    complement(83976..84719)
FT                   /note="FAD/NAD binding domain in the electron transfer
FT                   subunit of dihydroorotate dehydrogenase-like proteins.
FT                   Dihydroorotate dehydrogenases (DHODs) catalyze the only
FT                   redox reaction in pyrimidine de novo biosynthesis. They
FT                   catalyze the oxidation of (S)-...; Region:
FT                   DHOD_e_trans_like1; cd06219"
FT                   /db_xref="CDD:99815"
FT                   /locus_tag="Aboo_0085"
FT   misc_feature    complement(order(84081..84086,84399..84401,84513..84521,
FT                   84531..84539,84579..84590,84594..84596))
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99815"
FT                   /locus_tag="Aboo_0085"
FT   misc_feature    complement(order(84579..84584,84588..84590))
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99815"
FT                   /locus_tag="Aboo_0085"
FT   misc_feature    complement(order(84453..84455,84459..84461,84486..84488,
FT                   84498..84500,84507..84509,84516..84518))
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99815"
FT                   /locus_tag="Aboo_0085"
FT   misc_feature    complement(order(84387..84389,84393..84404,84414..84416))
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99815"
FT                   /locus_tag="Aboo_0085"
FT   misc_feature    complement(order(84156..84161,84321..84329,84396..84401))
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99815"
FT                   /locus_tag="Aboo_0085"
FT   misc_feature    complement(order(84012..84014,84048..84050,84057..84059,
FT                   84072..84074))
FT                   /note="Iron coordination center; other site"
FT                   /db_xref="CDD:99815"
FT                   /locus_tag="Aboo_0085"
FT   gene            complement(84785..85942)
FT                   /db_xref="GeneID:8827022"
FT                   /locus_tag="Aboo_0086"
FT   CDS_pept        complement(84785..85942)
FT                   /locus_tag="Aboo_0086"
FT                   /gene_family="HOG000042041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   tga:TGAM_0961 sarcosine oxidase, subunit beta (SoxB)"
FT                   /db_xref="GI:289595764"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:8827022"
FT                   /translation="MTMKNKVDIAIIGGGIIGLYTAFELAKRGVENIAVYEKRYIGSGS
FT                   TFRCGTGIRQQFGDEANIRMMKRSVEKWTTLGDEMDFPKFKMAKTGYLFLLYDEEEVKT
FT                   FKRNVALQNSLGVPSKVITPEEAKEIVPTLDISEVIAATFNQTDGKANPFLAVYGLARK
FT                   LRKMGIEINEYTEVKDIIVKDSQVEGVRTTKGEIKADIVLNAANAWAKIFNEKLGLNIP
FT                   IEPYKHQGIVSEPFKKGEIKPMVVSFKYGGAYFTQKANGGLIGGIALKYGPTWDLTPTY
FT                   EFLREVSRNFTRIIPALKHISIIRQWGGYYAETPDHNAVIGKIKEIEGYYLAAGFSGHG
FT                   FMLAPAVAEGMAELITKGHTSLPFDFYDPYRFERGELREQAVQMG"
FT                   /protein_id="YP_003482460.1"
FT   misc_feature    complement(84809..85936)
FT                   /note="Glycine/D-amino acid oxidases (deaminating) [Amino
FT                   acid transport and metabolism]; Region: DadA; COG0665"
FT                   /db_xref="CDD:31009"
FT                   /locus_tag="Aboo_0086"
FT   misc_feature    complement(84812..85888)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Aboo_0086"
FT   gene            complement(85926..86207)
FT                   /db_xref="GeneID:8827023"
FT                   /locus_tag="Aboo_0087"
FT   CDS_pept        complement(85926..86207)
FT                   /locus_tag="Aboo_0087"
FT                   /gene_family="HOG000092034" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /codon_start="1"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: tko:TK0121 proline dehydrogenase, delta
FT                   subunit"
FT                   /db_xref="GI:289595765"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="GeneID:8827023"
FT                   /translation="MVNKSKVIICRCNDVTQKDIEDLIEQGITDIELIKRITHIGMGPC
FT                   QGRTCLPLVAGIIARKTGKSYEEIGIPATRIPTKPVQMRILVGDDDEE"
FT                   /protein_id="YP_003482461.1"
FT   misc_feature    complement(86028..86186)
FT                   /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
FT                   cl01093"
FT                   /db_xref="CDD:174522"
FT                   /locus_tag="Aboo_0087"
FT   gene            complement(86208..86708)
FT                   /db_xref="GeneID:8827024"
FT                   /locus_tag="Aboo_0088"
FT   CDS_pept        complement(86208..86708)
FT                   /locus_tag="Aboo_0088"
FT                   /gene_family="HOG000223213" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /codon_start="1"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: pho:PH1750 ferredoxin"
FT                   /db_xref="GI:289595766"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:8827024"
FT                   /translation="MTEEYLERGYLTLEELKKKVELPSEERLQGKHPVAVPECPQRIPC
FT                   TPCKEICPVNAIKMDNPNDPPVVNYDRCIGCSLCVQICPGLAFFMIQYRDDKARVTMPH
FT                   ELLPMPKRGDEVILLNRKGEEVGKGKVVLVIPRDKSVGDTAVVTVEMPKELAWEVRAIK
FT                   VVV"
FT                   /protein_id="YP_003482462.1"
FT   misc_feature    complement(86214..>86609)
FT                   /note="Fe-S-cluster-containing hydrogenase components 2
FT                   [Energy production and conversion]; Region: HycB; COG1142"
FT                   /db_xref="CDD:31337"
FT                   /locus_tag="Aboo_0088"
FT   gene            complement(86701..88137)
FT                   /db_xref="GeneID:8827025"
FT                   /locus_tag="Aboo_0089"
FT   CDS_pept        complement(86701..88137)
FT                   /locus_tag="Aboo_0089"
FT                   /gene_family="HOG000223214" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tko:TK0119 proline dehydrogenase,
FT                   alpha subunit"
FT                   /db_xref="GI:289595767"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:8827025"
FT                   /translation="MRLEEHPVIDFSKRRGKKVTIYFEGKPIEAYEGEPIAEALHAAGI
FT                   RVLNYSTEKQRPRGLFCAIGKCSSCLMVVNGIPNTRTCITLVEDGMKIERQRGSQPLPR
FT                   DYKAPKWKDAEKHYGDIIIIGGGPAGLMAGIKAAEKGAKVILMDEEPILGGQLVKQTHK
FT                   FFGKREQFAGVRGIKIAEILAEEAKKNGVEIHLETSAVGIFDNNGEKLVVAIEKNKKLH
FT                   EFHGKAIVVATGAMEKMIPFENNDLPGVYGAGAIQTLMNTYGIEPGKRVLIVGAGNVGV
FT                   ILAYQLKQAGVDVVAIVEAMPKIGAYFVHAAKVRRLGIPIYTRHTILRAEGNEKVERAV
FT                   VAQIDEHWQPIPGTEKVYDVDVIALSVGLRPSIELLHQAGAQITYARELGGYVVRHDDR
FT                   METTVRGLFVAGDSSGIEEATTAMLEGKIAGLSAALLVGKAPVEAYEEIKKAQKDLEEF
FT                   RSGPFGKHILDGLKKVMIND"
FT                   /protein_id="YP_003482463.1"
FT   misc_feature    complement(<86815..88095)
FT                   /note="sarcosine oxidase, alpha subunit family,
FT                   heterotetrameric form; Region: soxA; TIGR01372"
FT                   /db_xref="CDD:162324"
FT                   /locus_tag="Aboo_0089"
FT   misc_feature    complement(87856..88086)
FT                   /note="2Fe-2S iron-sulfur cluster binding domain.
FT                   Iron-sulfur proteins play an important role in electron
FT                   transfer processes and in various enzymatic reactions. The
FT                   family includes plant and algal ferredoxins, which act as
FT                   electron carriers in photosynthesis...; Region: fer2;
FT                   cd00207"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Aboo_0089"
FT   misc_feature    complement(order(87889..87894,87928..87939,87943..87945,
FT                   87952..87954,87994..87999))
FT                   /note="catalytic loop; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Aboo_0089"
FT   misc_feature    complement(order(87889..87891,87928..87930,87937..87939,
FT                   87952..87954))
FT                   /note="iron binding site; other site"
FT                   /db_xref="CDD:29262"
FT                   /locus_tag="Aboo_0089"
FT   misc_feature    complement(<87436..>87603)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Aboo_0089"
FT   misc_feature    complement(87100..87330)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Aboo_0089"
FT   gene            88253..88498
FT                   /db_xref="GeneID:8827026"
FT                   /locus_tag="Aboo_0090"
FT   CDS_pept        88253..88498
FT                   /locus_tag="Aboo_0090"
FT                   /gene_family="HOG000227393" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /codon_start="1"
FT                   /product="PRC-barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: tvo:TVN1087
FT                   hypothetical protein"
FT                   /db_xref="GI:289595768"
FT                   /db_xref="InterPro:IPR007903"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="GeneID:8827026"
FT                   /translation="MMTEVTELIGLEIYTDKGYLLGTIKDVLLDVNDQIIYGLYVEKSN
FT                   PLLVEDGVPVVVPYRWVKAVGDVILLKKFPSYVNVT"
FT                   /protein_id="YP_003482464.1"
FT   misc_feature    88253..88477
FT                   /note="Photosynthetic reaction center (RC) complex, subunit
FT                   H;  RC is an integral membrane protein-pigment complex
FT                   which catalyzes light-induced reduction of ubiquinone to
FT                   ubiquinol, generating a transmembrane electrochemical
FT                   gradient of protons used to...; Region: PRCH; cl09959"
FT                   /db_xref="CDD:164180"
FT                   /locus_tag="Aboo_0090"
FT   gene            complement(88499..90172)
FT                   /db_xref="GeneID:8827027"
FT                   /locus_tag="Aboo_0091"
FT   CDS_pept        complement(88499..90172)
FT                   /locus_tag="Aboo_0091"
FT                   /gene_family="HOG000073585" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00463"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.17"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; KEGG:
FT                   mvu:Metvu_1350 glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   anti-codon binding domain"
FT                   /db_xref="GI:289595769"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020060"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="GeneID:8827027"
FT                   /translation="MEDLRDIILKYALQNAILHGGKANYKAVMGKIMAENPSLRSRAKE
FT                   LIEEVKKIVEEINSLSLEEQKKELEEIAPELLERKKKEERKELEDLPDVQGEVRMRLAP
FT                   SPSGPMHLGQSRMAILNDEYVKRYGGVLFLRIEDTNPHNILPEAYDMIPEDLEWLGVKV
FT                   HHIVIQSDRFEIYYDYAKKLLEMGKAYITTVPAEEWRKLKSEGKPTKDRELPPEEQLER
FT                   WEKMLAGEYDEGEAVYVVKTDLQHPNPAIRDWAAFRIIKDVEHPRLGNKYIVYPLMNFS
FT                   VAVDDHELQLTHVLRGKDHLNNTYRQMYLYDYFGWKKPVYIHYGWVTMKDTILKTSLIK
FT                   EGIRKGEYMGWDDPRLGTLRALAKRGIQPEAIRKYWVQVGLKEVDIEFSWDTLYAYNRE
FT                   LVDSKAKRYFFVWNPKEVEIRGVEKIEGKAPLHPNIDMGFREYKLSSPIKILVTMDDWK
FT                   GIENGEVFRLKDLCNVVKREEHLEYAGNDLSIVKRGAKIVHWVPEDSLPCKVYMPDGKS
FT                   LEGYAEKYVENSINEIVQFERFGFTKIYKEGELVGYFAHR"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /protein_id="YP_003482465.1"
FT   misc_feature    complement(88502..90136)
FT                   /note="glutamyl-tRNA synthetase; Provisional; Region: gltX;
FT                   PRK04156"
FT                   /db_xref="CDD:167720"
FT                   /locus_tag="Aboo_0091"
FT   misc_feature    complement(<89600..89884)
FT                   /note="nucleotidyl transferase superfamily; Region:
FT                   nt_trans; cl00015"
FT                   /db_xref="CDD:173983"
FT                   /locus_tag="Aboo_0091"
FT   misc_feature    complement(89831..89842)
FT                   /note="HIGH motif; other site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="Aboo_0091"
FT   misc_feature    complement(89831..89842)
FT                   /note="active site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="Aboo_0091"
FT   misc_feature    complement(order(89831..89833,89840..89842))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:173912"
FT                   /locus_tag="Aboo_0091"
FT   misc_feature    complement(88952..>89380)
FT                   /note="catalytic core domain of non-descriminating
FT                   glutamyl-tRNA and glutaminyl-tRNA synthetase; Region:
FT                   Gln_GluRS_non_core; cd00807"
FT                   /db_xref="CDD:173904"
FT                   /locus_tag="Aboo_0091"
FT   misc_feature    complement(89162..89176)
FT                   /note="KMSKS motif; other site"
FT                   /db_xref="CDD:173904"
FT                   /locus_tag="Aboo_0091"
FT   misc_feature    complement(88550..88960)
FT                   /note="tRNA synthetases class I (E and Q), anti-codon
FT                   binding domain; Region: tRNA-synt_1c_C; pfam03950"
FT                   /db_xref="CDD:146533"
FT                   /locus_tag="Aboo_0091"
FT   gene            complement(90211..91023)
FT                   /db_xref="GeneID:8827028"
FT                   /locus_tag="Aboo_0092"
FT   CDS_pept        complement(90211..91023)
FT                   /locus_tag="Aboo_0092"
FT                   /gene_family="HOG000045295" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: cts:Ctha_0890
FT                   integrase family protein"
FT                   /db_xref="GI:289595770"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="GeneID:8827028"
FT                   /translation="MPFDNKNITPKGRYELIGKLIEEIKLRKYSYRTGKAYIYVVKNYL
FT                   RSELTPREFLLKYYSDKSKSTIRQAYFALKFFYRNVLHERFNEEIPLAKKKEKLPVVLS
FT                   RDEVKRMIYGTHNIKHRLVLMFLYYAGMRLQEVRNIRWEDVEFEREIIHIKVAKGDKER
FT                   VVFLHPNLKNTLEIYGRKSKGYVFMSQRGKKYSPKSIQLIVKNAARRAKINKNVTPHTL
FT                   RHSFATHLLEGGADIRYIQQLLGHKHLKTTQIYTHVANKDIKKLAQLI"
FT                   /protein_id="YP_003482466.1"
FT   misc_feature    complement(90220..90945)
FT                   /note="site-specific tyrosine recombinase XerC; Reviewed;
FT                   Region: xerC; PRK00236"
FT                   /db_xref="CDD:166866"
FT                   /locus_tag="Aboo_0092"
FT   misc_feature    complement(90250..90837)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Aboo_0092"
FT   misc_feature    complement(order(90259..90261,90364..90372,90550..90552,
FT                   90622..90627))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Aboo_0092"
FT   misc_feature    complement(order(90259..90261,90286..90288,90355..90357,
FT                   90364..90366,90550..90552,90625..90627))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Aboo_0092"
FT   misc_feature    complement(order(90259..90261,90286..90288,90355..90357,
FT                   90364..90366,90625..90627))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Aboo_0092"
FT   gene            complement(91160..92113)
FT                   /db_xref="GeneID:8827029"
FT                   /locus_tag="Aboo_0093"
FT   CDS_pept        complement(91160..92113)
FT                   /locus_tag="Aboo_0093"
FT                   /gene_family="HOG000224189" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /codon_start="1"
FT                   /product="small GTP-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tsi:TSIB_1365 predicted GTPase, containing
FT                   NOG1 domain; TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related"
FT                   /db_xref="GI:289595771"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="GeneID:8827029"
FT                   /translation="MYRNIPTVLTAEEIIDKMFRRSKKVEVPLSKNRLRFHKNLSIAKI
FT                   YTARDVAVSTLKKYVDSFPYINKLHPFYRTLLDLLVDKDEYKKALASLVWAMEKISGFA
FT                   DKYARKIKGVGKVEEAIKFRKEFYGRTSSILKQIAPKLRYLGQVRDIIRKLPDINPELP
FT                   TVVIAGYPNVGKSELVSKMSTAKPEIASYPFTTKGIVVGHMEIRGRRVQIVDTPGLLDR
FT                   PLEKRNRIEKEAILALKYLADVIVFLLDPSETCGYSMDEQLKLLKEIKKDFDIPILEVE
FT                   NKVDLLCTDSQRIKISAKTGEGLEKLMGEVIARMEL"
FT                   /protein_id="YP_003482467.1"
FT   misc_feature    complement(91172..92113)
FT                   /note="Predicted GTPase [General function prediction only];
FT                   Region: COG1084"
FT                   /db_xref="CDD:31281"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(91172..91627)
FT                   /note="NOG1 is a nucleolar GTP-binding protein present in
FT                   eukaryotes ranging from trypanosomes to humans.  NOG1 is
FT                   functionally linked to ribosome biogenesis and found in
FT                   association with the nuclear pore complexes and identified
FT                   in many preribosomal...; Region: NOG; cd01897"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(91586..91609)
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(order(91217..91225,91259..91261,91265..91270,
FT                   91583..91594,91598..91600))
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(91517..91561)
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(91526..91528)
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(91460..91471)
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(91391..91462)
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(91259..91270)
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   misc_feature    complement(91217..91225)
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133297"
FT                   /locus_tag="Aboo_0093"
FT   gene            92184..94388
FT                   /db_xref="GeneID:8827030"
FT                   /locus_tag="Aboo_0094"
FT   CDS_pept        92184..94388
FT                   /locus_tag="Aboo_0094"
FT                   /gene_family="HOG000200402" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /codon_start="1"
FT                   /product="methionyl-tRNA synthetase"
FT                   /transl_table="11"
FT                   /note="KEGG: pho:PH0993 methionyl-tRNA synthetase; TIGRFAM:
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="GI:289595772"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002304"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="GeneID:8827030"
FT                   /translation="MRIFIGVAWPYANGPIHLGHIVGAYLPADIFARYQRMQGNEVLMV
FT                   SGSDEHGTPITITAEKEGKSPQEIADRYHKINSEVMEKLGISFDLYFRTSHPNHEKIVK
FT                   DFFLRLWENGYLYKKKMLLPYCPQCKRFLPDRYVVGTCPYCGYENAHGDQCDNCGRMLD
FT                   PKDLINPRCVICGTPTEFRETEHIFFALSKLEGTILKWLEDKTYWRDNVIKFTRNFVKG
FT                   GLKDRAITRDLEWGVEVPLEGFENKKIYVWFDAVIGYLSASIEWARRNNKDWEAFWKDE
FT                   NTRHYYFLGKDNIPFHTIIWPAMLMAHKGLNLPYNVVANEYLRFSGEKFSKSRGIGVWM
FT                   PELLENFHPDIIRFYGTVNMPESRDSDFTWDDFVQKVNEELIDKFANFVHRALIFAYRN
FT                   FGEVPPRGEVDEVDREAIKLIMQTIKKMNKYMESVELKKAFKEWLNLARYGNVYFDRKA
FT                   PWALCKEDREKCATAINISLQIVQALAILGAPFLPFTSERIWKFLGNEDSIFQHKYIEA
FT                   IKNLKVGEKLKKPEVLFEKIKREEEKYEKWEQIDLRVAEVESVEDHPNADKLYVLRINL
FT                   GDEKRTLIAGLKRFYKKEELLGKKLIIIANLEPANFRGIKSEGMLLAGEDESTVGFLTP
FT                   QGDVPPGSRVQANGVYSNPKGILKFKKFQKMKMEVVNIERENGKIVAKGNKDYPLDFKV
FT                   PEEWIGKQGVIFIDKKPLILHIGDVRIAPVKYVKPGGKIR"
FT                   /protein_id="YP_003482468.1"
FT   misc_feature    92184..93785
FT                   /note="methionyl-tRNA synthetase; Reviewed; Region:
FT                   PRK12268"
FT                   /db_xref="CDD:171354"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    92187..93287
FT                   /note="catalytic core domain of methioninyl-tRNA
FT                   synthetases; Region: MetRS_core; cd00814"
FT                   /db_xref="CDD:173907"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    order(92208..92210,92214..92216,92241..92243,92328..92330,
FT                   92937..92939,92946..92951,92958..92960,93060..93062,
FT                   93072..93074,93084..93086,93171..93173,93177..93179)
FT                   /note="active site"
FT                   /db_xref="CDD:173907"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    92232..92243
FT                   /note="HIGH motif; other site"
FT                   /db_xref="CDD:173907"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    93168..93182
FT                   /note="KMSKS motif; other site"
FT                   /db_xref="CDD:173907"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    93312..93692
FT                   /note="Anticodon-binding domain of methionyl tRNA
FT                   synthetases; Region: Anticodon_Ia_Met; cd07957"
FT                   /db_xref="CDD:153411"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    order(93315..93317,93336..93341,93348..93353,93360..93365,
FT                   93372..93377,93384..93386,93534..93539,93543..93548,
FT                   93561..93563)
FT                   /note="tRNA binding surface; other site"
FT                   /db_xref="CDD:153411"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    order(93336..93338,93348..93353,93360..93365,93372..93377,
FT                   93384..93386,93543..93545,93561..93563)
FT                   /note="anticodon binding site; other site"
FT                   /db_xref="CDD:153411"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    93828..94118
FT                   /note="The tRNA binding domain is also known as the Myf
FT                   domain in literature. This domain is found in a diverse
FT                   collection of tRNA binding proteins, including prokaryotic
FT                   phenylalanyl tRNA synthetases (PheRS), methionyl-tRNA
FT                   synthetases (MetRS), human tyrosyl-; Region:
FT                   tRNA_bindingDomain; cl00320"
FT                   /db_xref="CDD:174108"
FT                   /locus_tag="Aboo_0094"
FT   misc_feature    order(93885..93887,93921..93923,93999..94001,94011..94013,
FT                   94032..94034,94041..94043)
FT                   /note="putative tRNA-binding site; other site"
FT                   /db_xref="CDD:48398"
FT                   /locus_tag="Aboo_0094"
FT   gene            94385..95035
FT                   /db_xref="GeneID:8827031"
FT                   /locus_tag="Aboo_0095"
FT   CDS_pept        94385..95035
FT                   /locus_tag="Aboo_0095"
FT                   /gene_family="HOG000226983" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /codon_start="1"
FT                   /product="PHP domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mba:Mbar_A0352 isoleucyl-tRNA synthetase;
FT                   PFAM: PHP domain protein; SMART: phosphoesterase PHP domain
FT                   protein"
FT                   /db_xref="GI:289595773"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="GeneID:8827031"
FT                   /translation="MKVDMHTHSAYSPDGKVPIKDMLKRAKKIGLGAIAITDHNEIKGA
FT                   LKAKKLGILEVIRGIEVSTAQGHVLAYGIDCKIQRDLSIEETIEKIHDCGGIAVAAHPY
FT                   RFWSGIGEENVKRHDFDGIEVFNGRCKESSNRRARNLTAILHKPFTAGSDAHFLDEIGK
FT                   AGIIVDGEREEEIIEEILKKNVKTFGKSRGTSDTIRYVKKAVGEWIKRGFKKI"
FT                   /protein_id="YP_003482469.1"
FT   misc_feature    94385..>94879
FT                   /note="Predicted metal-dependent phosphoesterases (PHP
FT                   family) [General function prediction only]; Region:
FT                   COG0613"
FT                   /db_xref="CDD:30958"
FT                   /locus_tag="Aboo_0095"
FT   misc_feature    94394..94579
FT                   /note="DNA polymerase alpha chain like domain; Region:
FT                   POLIIIAc; cl02625"
FT                   /db_xref="CDD:174726"
FT                   /locus_tag="Aboo_0095"
FT   gene            complement(95032..95364)
FT                   /db_xref="GeneID:8827032"
FT                   /locus_tag="Aboo_0096"
FT   CDS_pept        complement(95032..95364)
FT                   /locus_tag="Aboo_0096"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /codon_start="1"
FT                   /product="Roadblock/LC7 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   rci:RCIX296 hypothetical protein"
FT                   /db_xref="GI:289595774"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="GeneID:8827032"
FT                   /translation="MSDTIRDALDSIGGIEGVEKVALISRTGMFIEGDSFDGGDTFSAM
FT                   SAIILGAAETATMGMGALKKVVVHLDDGKNLIITSVGKKGVLAVLADRDVYDEIEQIKG
FT                   RFENLI"
FT                   /protein_id="YP_003482470.1"
FT   gene            95465..96469
FT                   /db_xref="GeneID:8827033"
FT                   /locus_tag="Aboo_0097"
FT   CDS_pept        95465..96469
FT                   /locus_tag="Aboo_0097"
FT                   /gene_family="HOG000274120" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /codon_start="1"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_20387 hypothetical protein;
FT                   TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region"
FT                   /db_xref="GI:289595775"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="GeneID:8827033"
FT                   /translation="MKKFSAIVYIVIIAISIPLYLLMLHNLSSILILITNFIVGIYLLV
FT                   KGSDYFVEGAASIAAHKKISQHTIGLTLVALATSLPEFAVSTIASASNHPVTAWGNAVG
FT                   SNIANIGLVLGIAAVLMPLSLSKHVKKDAAILVTVTGILILIALITREIAWWAGLLFIG
FT                   IYGAYLWEIRKREEDVESVPIEHSWLWSWIYTIFGAIGIVWGAKVVVESAVNLAIVLHI
FT                   PEIIIAITAIAIGTSLPEMATSVTAALKKKYGIAVGNVIGSNIFNTLIVLGGASLFNPI
FT                   KVPMNDIVFNSTFLGIFTVAAALMCIKKKIRRFEGFALILLYIIFFVFLLYYS"
FT                   /protein_id="YP_003482471.1"
FT   misc_feature    95555..96418
FT                   /note="K+-dependent Na+/Ca+ exchanger related-protein;
FT                   Region: TIGR00367"
FT                   /db_xref="CDD:129464"
FT                   /locus_tag="Aboo_0097"
FT   misc_feature    95591..95974
FT                   /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
FT                   pfam01699"
FT                   /db_xref="CDD:145053"
FT                   /locus_tag="Aboo_0097"
FT   misc_feature    96062..96418
FT                   /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
FT                   pfam01699"
FT                   /db_xref="CDD:145053"
FT                   /locus_tag="Aboo_0097"
FT   gene            complement(96460..96978)
FT                   /db_xref="GeneID:8827034"
FT                   /locus_tag="Aboo_0098"
FT   CDS_pept        complement(96460..96978)
FT                   /locus_tag="Aboo_0098"
FT                   /gene_family="HOG000073586" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01870"
FT                   /codon_start="1"
FT                   /product="Resolvase, Holliday junction-type"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase, Holliday junction-type; KEGG:
FT                   tvo:TVN0025 hypothetical protein"
FT                   /db_xref="GI:289595776"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="GeneID:8827034"
FT                   /translation="MGSKGSIYERELKGILSGEDRIISKFKKSLGEDFRWYESSKFKPF
FT                   MVLRAAGSLGVDLVAIRDDYSFPIEVKSSSSKTIIFTHSSSRAQEQAQRFLEECKSAKI
FT                   LGLYAFRLKGYRGDPWRIFALPVGGLSGRIKLLYDILPKLPVTREGNFILKWDEGMPLA
FT                   KFLSYVNQE"
FT                   /protein_id="YP_003482472.1"
FT   misc_feature    complement(96601..96957)
FT                   /note="Superfamily of nucleases including Short Patch
FT                   Repair (Vsr) Endonucleases, archaeal Holliday junction
FT                   resolvases, MutH methy-directed DNA mismatch-repair
FT                   endonucleases, and catalytic domains of many restriction
FT                   endonucleases, such as EcoRI, BamHI, and...; Region:
FT                   Restriction_endonuclease_like; cl00277"
FT                   /db_xref="CDD:174085"
FT                   /locus_tag="Aboo_0098"
FT   gene            97058..97567
FT                   /db_xref="GeneID:8827035"
FT                   /locus_tag="Aboo_0099"
FT   CDS_pept        97058..97567
FT                   /locus_tag="Aboo_0099"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /codon_start="1"
FT                   /product="CBS domain containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tsi:TSIB_2005 hypothetical protein; PFAM: CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="GI:289595777"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:8827035"
FT                   /translation="MSEDHKDIRYVLKNFYRVPVEHIMTKNLWDMPILPKDASIEDVLS
FT                   IMSARRHVWIVDKKGSKKVIGIITEKDLLDILAPKRIQPYVIGSIDLTSLLLGNVRKAE
FT                   DIMCKKLIVAHPNDTIEDALDKMRSFRLRRLPVVNEKGELMGELTIKSLIIQFRKVLKW
FT                   YRITKD"
FT                   /protein_id="YP_003482473.1"
FT   misc_feature    97115..97519
FT                   /note="FOG: CBS domain [General function prediction only];
FT                   Region: COG0517"
FT                   /db_xref="CDD:30863"
FT                   /locus_tag="Aboo_0099"
FT   misc_feature    97145..97519
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so-...; Region: CBS_pair; cd02205"
FT                   /db_xref="CDD:73081"
FT                   /locus_tag="Aboo_0099"
FT   gene            complement(97568..98695)
FT                   /db_xref="GeneID:8827036"
FT                   /locus_tag="Aboo_0100"
FT   CDS_pept        complement(97568..98695)
FT                   /locus_tag="Aboo_0100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cyh:Cyan8802_1328 peptidase S1 and S6
FT                   chymotrypsin/Hap; PFAM: TPR repeat-containing protein;
FT                   SMART: Tetratricopeptide repeat"
FT                   /db_xref="GI:289595778"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="GeneID:8827036"
FT                   /translation="MEKNIAVILALNTLTVVFGWVIYLAGVPPNTNLFIFAAESIMLLG
FT                   LISLAITFIYVFMSGNINKLFLPALIVLGGGVILTFFAWFIGGLVVLISLLILILSKKT
FT                   MYKRWEYIALIFSGFLILTIVPPIEAFLNVYALSMDYGVIIFSVALIVAGLCLLSKKTL
FT                   DLEGNLIFIILSISFFLLPPFHEIFKIKSNGSFGIYDNAIIIASTIVYVIFAVGLIYAS
FT                   IKKDKIMKVIDEGYKLLERGKWEDAYGLFRKISENGYRDAKLFNGIGIALMHLGKFDDA
FT                   EVFLRESVNMEDNDVYLTNLGNLHYRKGDVDRAMKIYSKVLKRNPDCYLALNNMGRALM
FT                   KKGKKEEAEKYLKKAIKINPNGKTAKRNYSMINME"
FT                   /protein_id="YP_003482474.1"
FT   misc_feature    complement(97715..98002)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Aboo_0100"
FT   misc_feature    complement(order(97772..97777,97784..97789,97796..97801,
FT                   97874..97879,97886..97891,97895..97900,97985..97990,
FT                   97997..98002))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Aboo_0100"
FT   misc_feature    complement(order(97733..97735,97742..97744,97754..97756,
FT                   97790..97792,97832..97834,97841..97843,97853..97855,
FT                   97889..97891,97934..97936,97943..97945,97955..97957,
FT                   97991..97993))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Aboo_0100"
FT   gene            98779..99522
FT                   /db_xref="GeneID:8827037"
FT                   /locus_tag="Aboo_0101"
FT   CDS_pept        98779..99522
FT                   /locus_tag="Aboo_0101"
FT                   /gene_family="HOG000004695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /codon_start="1"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: tko:TK1397 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="GI:289595779"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="GeneID:8827037"
FT                   /translation="MSKWDKKWIILGHRGFRSNFPENTLKSFGEAIKAGADGIELDVWL
FT                   SSDGYAIISHDEDLERVSGVHMKIKDSKLEDIKSVDIGEGERVPTLDEVFSTLPKNALI
FT                   NIEIKDVDAVEKSIDIVRKWRAEDRVMFSSFNIDALREIRKKDEDTIIGLLIEKKETLP
FT                   MIPQINKELKLFSVNLPIDAIEIFSFEKFKNTILWVKGMGLKIVLWADKDEIYYLNGNI
FT                   DKLKDLVDIVITDNVVKMREHLSKD"
FT                   /protein_id="YP_003482475.1"
FT   misc_feature    98803..99516
FT                   /note="Catalytic domain of phosphoinositide-specific
FT                   phospholipase C-like phosphodiesterases superfamily;
FT                   Region: PI-PLCc_GDPD_SF; cl14615"
FT                   /db_xref="CDD:176625"
FT                   /locus_tag="Aboo_0101"
FT   misc_feature    98815..99495
FT                   /note="Glycerophosphoryl diester phosphodiesterase family;
FT                   Region: GDPD; pfam03009"
FT                   /db_xref="CDD:145909"
FT                   /locus_tag="Aboo_0101"
FT   gene            99549..100367
FT                   /db_xref="GeneID:8827038"
FT                   /locus_tag="Aboo_0102"
FT   CDS_pept        99549..100367
FT                   /locus_tag="Aboo_0102"
FT                   /gene_family="HOG000218242" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.5.1.5"
FT                   /codon_start="1"
FT                   /EC_number="1.5.1.5"
FT                   /transl_table="11"
FT                   /note="KEGG: tte:TTE1293 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase; PFAM: Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain;
FT                   Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic
FT                   domain"
FT                   /db_xref="GI:289595780"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="GeneID:8827038"
FT                   /translation="MIIECKTLAKEIRENAKKEAKGKKLWLHNIVVGEDEASLVYARSN
FT                   LKLLRKLGFDGKIHHLEEASEKELLDLIQALNEDNSMHGIMVNFPLPDNIDPMKVRSTI
FT                   SPIKDVDGINPINYGKLLLGEEILTPNTPRAVIRILERETELRGKDVLIINRTPVVGKP
FT                   LSLLLLNRDATPTIAHSKTRNLKEKALEADVIVVAVGKPKFLKEDMVHEGAIVIDVGIN
FT                   VVNGKIVGDADFESIEKKAKITPVPGGVGTVTNACLIENLVKAAKLQGVI"
FT                   /product="Methylenetetrahydrofolate dehydrogenase
FT                   (NADP(+))"
FT                   /protein_id="YP_003482476.1"
FT   misc_feature    99549..100355
FT                   /note="5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase
FT                   [Coenzyme metabolism]; Region: FolD; COG0190"
FT                   /db_xref="CDD:30539"
FT                   /locus_tag="Aboo_0102"
FT   misc_feature    99549..99881
FT                   /note="Tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   catalytic domain; Region: THF_DHG_CYH; pfam00763"
FT                   /db_xref="CDD:144385"
FT                   /locus_tag="Aboo_0102"
FT   misc_feature    99864..100349
FT                   /note="NADP binding domain of methylene-tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase; Region:
FT                   NAD_bind_m-THF_DH_Cyclohyd; cd01080"
FT                   /db_xref="CDD:133448"
FT                   /locus_tag="Aboo_0102"
FT   misc_feature    order(99891..99896,99903..99905,99990..99992,99996..99998,
FT                   100014..100016,100041..100046,100053..100055,
FT                   100062..100079,100083..100085,100089..100094,
FT                   100119..100121)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:133448"
FT                   /locus_tag="Aboo_0102"
FT   misc_feature    order(99942..99944,100014..100019,100083..100088,
FT                   100143..100145,100149..100151,100158..100160,
FT                   100191..100193,100197..100199,100299..100301,
FT                   100308..100310)
FT                   /note="NADP binding site; other site"
FT                   /db_xref="CDD:133448"
FT                   /locus_tag="Aboo_0102"
FT   misc_feature    order(100287..100292,100311..100313)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:133448"
FT                   /locus_tag="Aboo_0102"
FT   gene            100364..101296
FT                   /db_xref="GeneID:8827039"
FT                   /locus_tag="Aboo_0103"
FT   CDS_pept        100364..101296
FT                   /locus_tag="Aboo_0103"
FT                   /gene_family="HOG000228009" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /codon_start="1"
FT                   /product="putative RNA methylase"
FT                   /transl_table="11"
FT                   /note="PFAM: putative RNA methylase; KEGG: tsi:TSIB_0468
FT                   N2, N2-dimethylguanosine tRNA methyltransferase"
FT                   /db_xref="GI:289595781"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="GeneID:8827039"
FT                   /translation="MKLIAEMWGEKIDFAIGEINGICEGEELNCKIINVDYPVVILEAE
FT                   DYIPIKRAGLLRRLSKFIYSGSNIPELGIELEDYAIRVRKNGNWKEREIIKSLARGIEG
FT                   NVNLENPRNIVRVYAGKNLHVGLELYDFAEQSFESRRAKNLPISYPITMHPRLARAMIN
FT                   LARVKKGARILDPFCGTGSILIEGALIGMKMYGSDIDERMLKASQTNLKRFGLEAILEK
FT                   KDVGEIEGYYGAIVTDPPYGRSSSSMGEGIYKLYDRAFKKFSEVTSKVVIALPDEKSIK
FT                   IGERYFELREFYPYRVHKSLTRYFLYFHI"
FT                   /protein_id="YP_003482477.1"
FT   misc_feature    100454..101281
FT                   /note="conserved hypothetical protein TIGR01177; Region:
FT                   TIGR01177"
FT                   /db_xref="CDD:162239"
FT                   /locus_tag="Aboo_0103"
FT   misc_feature    100799..101278
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Aboo_0103"
FT   gene            complement(101265..101495)
FT                   /db_xref="GeneID:8827040"
FT                   /locus_tag="Aboo_0104"
FT   CDS_pept        complement(101265..101495)
FT                   /locus_tag="Aboo_0104"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gfo:GFO_2048 small-conductance
FT                   mechanosensitive ion channel protein"
FT                   /db_xref="GI:289595782"
FT                   /db_xref="GeneID:8827040"
FT                   /translation="MGRLVLYLTAYIPLLIITIIFSYVGYLHKAKKYKRIFYKTLRKEG
FT                   VPRKSAKVLTAQIKILKFRELVKYGNIRSIL"
FT                   /protein_id="YP_003482478.1"
FT   gene            complement(101506..101889)
FT                   /db_xref="GeneID:8827041"
FT                   /locus_tag="Aboo_0105"
FT   CDS_pept        complement(101506..101889)
FT                   /locus_tag="Aboo_0105"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:TSIB_1658"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tsi:TSIB_1658 hypothetical protein"
FT                   /db_xref="GI:289595783"
FT                   /db_xref="GeneID:8827041"
FT                   /translation="MSEERKEVDDDEKDIEEFKEVMSTLRDFIPAMIREIVEALYSGQS
FT                   AEEFGKQVANFYKSLVDAGMSNEQAFTLTQKFMESRDVVGILKKILSEGNWGKWKNENV
FT                   NPEEIAEQVMKEVNEELKKEKES"
FT                   /protein_id="YP_003482479.1"
FT   gene            complement(101905..102339)
FT                   /db_xref="GeneID:8827042"
FT                   /locus_tag="Aboo_0106"
FT   CDS_pept        complement(101905..102339)
FT                   /locus_tag="Aboo_0106"
FT                   /gene_family="HOG000073587" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PF0297"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pfu:PF0297 hypothetical protein"
FT                   /db_xref="GI:289595784"
FT                   /db_xref="GeneID:8827042"
FT                   /translation="MDDLEKRIRKVEDLLEKYLENDYLVYIRHILASYLRLINIYVEYG
FT                   KISPTIIFPEIKDSISREIIEILFSYGSLNTSQITDELKKSRGKASRRIVREKLNNLVE
FT                   AGIVECDERKNERIYSISEYAVKKWLKVLGINIKGDVHKE"
FT                   /protein_id="YP_003482480.1"
FT   misc_feature    complement(101941..102153)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Aboo_0106"
FT   gene            102442..103683
FT                   /db_xref="GeneID:8827043"
FT                   /locus_tag="Aboo_0107"
FT   CDS_pept        102442..103683
FT                   /locus_tag="Aboo_0107"
FT                   /gene_family="HOG000238519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00079"
FT                   /codon_start="1"
FT                   /product="proteinase inhibitor I4 serpin"
FT                   /transl_table="11"
FT                   /note="KEGG: mac:MA2246 squamous cell carcinoma antigen;
FT                   PFAM: proteinase inhibitor I4 serpin; SMART: proteinase
FT                   inhibitor I4 serpin"
FT                   /db_xref="GI:289595785"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="GeneID:8827043"
FT                   /translation="MKTRKVSSIITLILTALLLGTYIFQNAPTTQNSNKNLRPQWNNGG
FT                   VNTENLQALGYANNRFALSLFNEIWGQENNTFFSPLSIWIVLAMLYEGAEGESAAQLEK
FT                   VLYLPKNKTILQENIKYLLDELNNGGNYTLKIANALWPQINSSVKQEYAEVLENYYYAY
FT                   LQYLNYAKDPEKAIETINSWVENQTNRKIKNLLHKGDVNPQTILVLTNAIYFYGLWNYP
FT                   FNASKTNNGYFLTPHGRVKVKMMHGEFTLKYTEDKNAQVVELPYKGKNISMLVILPKTQ
FT                   DFEINLTKIQKWIENLRDARVNISFPRFDMKEKLNLKNSLERLGIKDIFNPAKANLSGI
FT                   SQSISVSNIVHQSYVKVDENGTEAAAATGVSVVATALPLLPHVVFNADHPFLFLIMDKI
FT                   TGSILFMGWVAYPS"
FT                   /protein_id="YP_003482481.1"
FT   misc_feature    102610..103662
FT                   /note="SERine Proteinase INhibitors (serpins) exhibit
FT                   conformational polymorphism shifting from native to
FT                   cleaved, latent, delta, or polymorphic forms. Many serpins,
FT                   such as antitrypsin and antichymotrypsin, function as
FT                   serine protease inhibitors which...; Region: SERPIN;
FT                   cd00172"
FT                   /db_xref="CDD:29117"
FT                   /locus_tag="Aboo_0107"
FT   misc_feature    order(103522..103533,103594..103611)
FT                   /note="reactive center loop; other site"
FT                   /db_xref="CDD:29117"
FT                   /locus_tag="Aboo_0107"
FT   gene            103719..104246
FT                   /db_xref="GeneID:8827044"
FT                   /locus_tag="Aboo_0108"
FT   CDS_pept        103719..104246
FT                   /locus_tag="Aboo_0108"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: msi:Msm_1769 hypothetical protein"
FT                   /db_xref="GI:289595786"
FT                   /db_xref="GeneID:8827044"
FT                   /translation="MKYCPNCGAKLSDNSNFCPFCGAKLEDFIVYEKPKIEITPDLICR
FT                   HCGKGKLMLVDADSDIPLYMCPHCGWYYGDFLGIGRAIYYDSIHLKIGRIIKAEIRMRG
FT                   HLRVNIKSTSDWEEEGLTELSKYLHDDLKEYSISDIRDALVYLLEENVIKSYTEKIDDE
FT                   FIWFGVRFVDSD"
FT                   /protein_id="YP_003482482.1"
FT   misc_feature    103719..>103940
FT                   /note="putative protein serine/threonine phosphatase;
FT                   Provisional; Region: PRK14559"
FT                   /db_xref="CDD:173024"
FT                   /locus_tag="Aboo_0108"
FT   misc_feature    103722..103784
FT                   /note="Uncharacterized protein family UPF0547; Region:
FT                   UPF0547; pfam10571"
FT                   /db_xref="CDD:151108"
FT                   /locus_tag="Aboo_0108"
FT   gene            104239..105027
FT                   /db_xref="GeneID:8827045"
FT                   /locus_tag="Aboo_0109"
FT   CDS_pept        104239..105027
FT                   /locus_tag="Aboo_0109"
FT                   /gene_family="HOG000227188" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01798"
FT                   /codon_start="1"
FT                   /product="Pre-mRNA processing ribonucleoprotein, binding
FT                   domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Pre-mRNA processing ribonucleoprotein, binding
FT                   domain protein; KEGG: mtp:Mthe_0831 pre-mRNA processing
FT                   ribonucleoprotein, binding region"
FT                   /db_xref="GI:289595787"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="GeneID:8827045"
FT                   /translation="MIKWYGAFKIEENTKEKYIFPDEQRADIIVKIREGDYSVLPFDDE
FT                   NIVFEGELKDRSTLISTAIEVAKREMKEKLGDDYILIENLNTYDDLISTINLLNERLLE
FT                   WDRIAEIKGKDMRSGEMLKKEIETLEKLKEDIADEIDDLSNVLCPNLAFLVGPIIAARL
FT                   IASAGGLRRLANLPASTIQVLGAEEAFFRHLKSGAKCPKHGIIFRVPWVRNSPKKLRGK
FT                   IARALAAKIAIAAKIDYYKGDFIGDKLKEEMEKRVEEIRK"
FT                   /protein_id="YP_003482483.1"
FT   misc_feature    104251..105024
FT                   /note="Protein implicated in ribosomal biogenesis, Nop56p
FT                   homolog [Translation, ribosomal structure and biogenesis];
FT                   Region: SIK1; COG1498"
FT                   /db_xref="CDD:31687"
FT                   /locus_tag="Aboo_0109"
FT   misc_feature    104641..105021
FT                   /note="Putative snoRNA binding domain; Region: Nop;
FT                   pfam01798"
FT                   /db_xref="CDD:145126"
FT                   /locus_tag="Aboo_0109"
FT   gene            105024..105398
FT                   /db_xref="GeneID:8827046"
FT                   /locus_tag="Aboo_0110"
FT   CDS_pept        105024..105398
FT                   /locus_tag="Aboo_0110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /codon_start="1"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /transl_table="11"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   tga:TGAM_0172 MoaE molybdopterin synthase, large chain
FT                   (MoaE)"
FT                   /db_xref="GI:289595788"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="GeneID:8827046"
FT                   /translation="MIIIDRKSERDLFSLIQQNGSGSIVSYFGYVREEVDGKIVSNMLC
FT                   KKREDSVKIMEKIENEIREEFPVIDVILYHSLGDLKVGELVAAVIVSSVHRAEGFEACR
FT                   YGIDKIKELEPVERKDIFKE"
FT                   /protein_id="YP_003482484.1"
FT   misc_feature    105054..105395
FT                   /note="MoaE family. Members of this family are involved in
FT                   biosynthesis of the molybdenum cofactor (Moco), an
FT                   essential cofactor for a diverse group of redox enzymes.
FT                   Moco biosynthesis is an evolutionarily conserved pathway
FT                   present in eubacteria, archaea and...; Region: MoaE;
FT                   cd00756"
FT                   /db_xref="CDD:58647"
FT                   /locus_tag="Aboo_0110"
FT   misc_feature    order(105060..105062,105072..105074,105087..105089,
FT                   105093..105107,105111..105113,105117..105119,
FT                   105276..105278,105303..105305,105309..105311,
FT                   105333..105335,105345..105347)
FT                   /note="MoaE homodimer interface; other site"
FT                   /db_xref="CDD:58647"
FT                   /locus_tag="Aboo_0110"
FT   misc_feature    order(105156..105158,105162..105164,105171..105173,
FT                   105180..105182,105192..105194,105246..105248,
FT                   105354..105359,105363..105365,105369..105377)
FT                   /note="MoaD interaction; other site"
FT                   /db_xref="CDD:58647"
FT                   /locus_tag="Aboo_0110"
FT   misc_feature    order(105354..105356,105375..105377)
FT                   /note="active site residues"
FT                   /db_xref="CDD:58647"
FT                   /locus_tag="Aboo_0110"
FT   gene            105447..105833
FT                   /db_xref="GeneID:8827047"
FT                   /locus_tag="Aboo_0111"
FT   CDS_pept        105447..105833
FT                   /locus_tag="Aboo_0111"
FT                   /gene_family="HOG000256281" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /codon_start="1"
FT                   /product="OsmC family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: OsmC family protein; KEGG: tsi:TSIB_0754
FT                   predicted stress-inducible protein, OsmC/Ohr family"
FT                   /db_xref="GI:289595789"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="GeneID:8827047"
FT                   /translation="MRVRVHDDLLITAEDESTALLLSGNGKAMSPMKALLASLGGCTGI
FT                   DVLMILKKMREDVKEVNVYIDYERAKEYPKIYTKINLKYVVIGNVKKESVERAIKLSEE
FT                   KYCSVSAMLSKTTEINRSYEIVEG"
FT                   /protein_id="YP_003482485.1"
FT   misc_feature    105450..105827
FT                   /note="OsmC-like protein; Region: OsmC; cl00767"
FT                   /db_xref="CDD:174381"
FT                   /locus_tag="Aboo_0111"
FT   gene            105836..106486
FT                   /db_xref="GeneID:8827048"
FT                   /locus_tag="Aboo_0112"
FT   CDS_pept        105836..106486
FT                   /locus_tag="Aboo_0112"
FT                   /gene_family="HOG000281217" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /codon_start="1"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: mba:Mbar_A1238
FT                   4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate
FT                   synthesis protein ThiF"
FT                   /db_xref="GI:289595790"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8827048"
FT                   /translation="MLRYSRQEGLVDQDKLKNASVLIAGVGGLGGFSSIYLAVAGVGNI
FT                   VIVDKDVVEESNLNRQILYREGDIGKKKVMVARKRLKELNPDVKIIAIDKSIDEKFEVV
FT                   QKIDIVVDGLDNYESRIALEKFALQKHIPYVFGAVEGYMGMVTFIDDSTKKLEDFIQHF
FT                   KLKTPQVLASTSAFTASIQSMEVLKYLSKKGDLLRNRLLIYDALSTNFLEVKL"
FT                   /protein_id="YP_003482486.1"
FT   misc_feature    105836..106483
FT                   /note="molybdopterin biosynthesis protein MoeB;
FT                   Provisional; Region: PRK05690"
FT                   /db_xref="CDD:168183"
FT                   /locus_tag="Aboo_0112"
FT   misc_feature    105842..106483
FT                   /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
FT                   in molybdopterin and thiamine biosynthesis family. The
FT                   common reaction mechanism catalyzed by MoeB and ThiF, like
FT                   other E1 enzymes, begins with a nucleophilic attack of the
FT                   C-terminal carboxylate of...; Region:
FT                   ThiF_MoeB_HesA_family; cd00757"
FT                   /db_xref="CDD:30111"
FT                   /locus_tag="Aboo_0112"
FT   misc_feature    order(105908..105910,105914..105916,105920..105922,
FT                   105980..105982,105986..105988,106013..106015,
FT                   106052..106054,106172..106174,106190..106192)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:30111"
FT                   /locus_tag="Aboo_0112"
FT   misc_feature    order(105920..105922,106175..106183,106193..106195,
FT                   106247..106252,106262..106264,106268..106270,
FT                   106436..106438,106448..106450,106469..106471,
FT                   106475..106480)
FT                   /note="substrate interface; other site"
FT                   /db_xref="CDD:30111"
FT                   /locus_tag="Aboo_0112"
FT   gene            106483..106716
FT                   /db_xref="GeneID:8827049"
FT                   /locus_tag="Aboo_0113"
FT   CDS_pept        106483..106716
FT                   /locus_tag="Aboo_0113"
FT                   /gene_family="HOG000280991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01687"
FT                   /codon_start="1"
FT                   /product="MoaD family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tko:TK2118 molybdopterin converting factor,
FT                   subunit 1; TIGRFAM: MoaD family protein; PFAM: thiamineS
FT                   protein"
FT                   /db_xref="GI:289595791"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="GeneID:8827049"
FT                   /translation="MRVHIRYFGRFAADIGKFSEEIEFDDKATVKDLVEFLKRKYPFLK
FT                   DEVIEVSINGKYAKNDDPLAPEISVFPIISGG"
FT                   /protein_id="YP_003482487.1"
FT   misc_feature    106489..106713
FT                   /note="Ubiquitin domain of MoaD-like proteins; Region:
FT                   MoaD; cd00754"
FT                   /db_xref="CDD:176354"
FT                   /locus_tag="Aboo_0113"
FT   misc_feature    order(106504..106512,106516..106521,106642..106644,
FT                   106681..106683,106696..106704,106711..106713)
FT                   /note="MoaE interaction surface; other site"
FT                   /db_xref="CDD:176354"
FT                   /locus_tag="Aboo_0113"
FT   misc_feature    order(106504..106509,106516..106521,106696..106698,
FT                   106702..106704,106711..106713)
FT                   /note="MoeB interaction surface; other site"
FT                   /db_xref="CDD:176354"
FT                   /locus_tag="Aboo_0113"
FT   misc_feature    106711..106713
FT                   /note="thiocarboxylated glycine; other site"
FT                   /db_xref="CDD:176354"
FT                   /locus_tag="Aboo_0113"
FT   gene            complement(106717..107799)
FT                   /db_xref="GeneID:8827050"
FT                   /locus_tag="Aboo_0114"
FT   CDS_pept        complement(106717..107799)
FT                   /locus_tag="Aboo_0114"
FT                   /gene_family="HOG000073588" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /codon_start="1"
FT                   /product="peptidase M24"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG: pab:PAB2178
FT                   x-pro dipeptidase"
FT                   /db_xref="GI:289595792"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="GeneID:8827050"
FT                   /translation="MISLRAPREIFEKRVQKFQSILRENNVDGAVIRALSTFTYFTGTR
FT                   WLRPSLLIPSEGEPTVLVVEGEAEEFKRRSWIDDVVEYQDAESLMAMVVSWIKSNGYKR
FT                   VGLEFSVERDAYLLFYKVFKRLNPQVEVVDILDYTFQLRMVKDEWEKENIRKAGRIANK
FT                   GMKLAGEVISPGMSELEIASEVGHLLTKEGSEDPKVYVSTTPRVHAEPFRDAYVKKDSI
FT                   VTVVIGADYNNYYANMARTFVVGEVNKEVRRAMQVKERAYELAIRETKPDKKFIEIEKK
FT                   IAELYRHERFEEYYIKGYTHSVGLLIEEPPITTIVVAHRFWKIMRDMVLAIVHPPLMLP
FT                   EGAIKHEDTFIVEDEMEKVT"
FT                   /protein_id="YP_003482488.1"
FT   misc_feature    complement(106720..107796)
FT                   /note="Xaa-Pro aminopeptidase [Amino acid transport and
FT                   metabolism]; Region: PepP; COG0006"
FT                   /db_xref="CDD:30356"
FT                   /locus_tag="Aboo_0114"
FT   misc_feature    complement(107365..107760)
FT                   /note="Creatinase/Prolidase N-terminal domain; Region:
FT                   Creatinase_N; pfam01321"
FT                   /db_xref="CDD:144790"
FT                   /locus_tag="Aboo_0114"
FT   misc_feature    complement(106735..107346)
FT                   /note="A family including aminopeptidase P, aminopeptidase
FT                   M, and prolidase. Also known as metallopeptidase family
FT                   M24. This family of enzymes is able to cleave amido-,
FT                   imido- and amidino-containing bonds. Members exibit
FT                   relatively narrow substrate...; Region: APP_MetAP; cd01066"
FT                   /db_xref="CDD:29969"
FT                   /locus_tag="Aboo_0114"
FT   misc_feature    complement(order(106759..106761,106801..106803,
FT                   106897..106899,107089..107091,107122..107124))
FT                   /note="active site"
FT                   /db_xref="CDD:29969"
FT                   /locus_tag="Aboo_0114"
FT   gene            complement(107796..109112)
FT                   /db_xref="GeneID:8827051"
FT                   /locus_tag="Aboo_0115"
FT   CDS_pept        complement(107796..109112)
FT                   /locus_tag="Aboo_0115"
FT                   /gene_family="HOG000227803" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04282"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF438"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF438;
FT                   Hemerythrin HHE cation binding domain protein; KEGG:
FT                   ton:TON_0479 hypothetical protein"
FT                   /db_xref="GI:289595793"
FT                   /db_xref="InterPro:IPR007380"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="GeneID:8827051"
FT                   /translation="MSELLDNREMKKEKLKEMLKKLHSGEDEEKVKEEFKNVLRSISPL
FT                   EIPLIEQELVAEGVSAREIARMCDIHVEIFRESVSGAEKEIAKFPPGHPLRTLYEENVE
FT                   IIKDAEILNLYASSLLKLKGNALQSTLKTLEGIVRGLKVIGYTHYNREEMIDFPYLERR
FT                   GLNAVPAVLWRKHDEIRAEMNKLLNLIHSENYEEISNVGQDLASRLIDMVFRENNILYP
FT                   TLQVLLSEGEFKAIRMQDDEIGYYKIKPGNEWKSEAKPIMPYEVRDEITAEQLLSLPQH
FT                   LIEEMKKNMGDIKLHPDLRELRREGDIELENGYLLPDEISAILAIMPVDVTFIDSEDRV
FT                   RFFSGGERIFTRTNTVLGRPVQLCHPPKSVHIVNKILQAFKKGERDKADFWIDMQGRKI
FT                   LIQYLAVRKNGKYLGALEFTQDIMDIKKIEGEKRLLDWK"
FT                   /protein_id="YP_003482489.1"
FT   misc_feature    complement(107805..109046)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG2461"
FT                   /db_xref="CDD:32573"
FT                   /locus_tag="Aboo_0115"
FT   misc_feature    complement(108834..109046)
FT                   /note="Family of unknown function (DUF438); Region: DUF438;
FT                   pfam04282"
FT                   /db_xref="CDD:146754"
FT                   /locus_tag="Aboo_0115"
FT   gene            complement(109190..109807)
FT                   /db_xref="GeneID:8827052"
FT                   /locus_tag="Aboo_0116"
FT   CDS_pept        complement(109190..109807)
FT                   /locus_tag="Aboo_0116"
FT                   /gene_family="HOG000155781" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.3"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: thiamine-phosphate pyrophosphorylase; KEGG:
FT                   pfu:PF1334 thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase"
FT                   /db_xref="GI:289595794"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8827052"
FT                   /translation="MNLREKLKLYVITDGRLRDEIESVKLVLEGGAKAIQLRMKNSTTR
FT                   QMVEKGIRIRKIVEDYGALLFVDDRVDVALAIEAHGVHLGPEDMPLKMARIIAPQLLIG
FT                   ATVHSVEEAIKAQEDGADYIGAGSVYPTRSKENAVVIGLENLRRIVESVRIPVVAIGGI
FT                   NIENVRNVLSTGVDGIAVISSILVAENPKEATRRMLREIEGR"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /protein_id="YP_003482490.1"
FT   misc_feature    complement(109208..109783)
FT                   /note="Thiamine monophosphate synthase (TMP synthase)/TenI.
FT                   TMP synthase catalyzes an important step in the thiamine
FT                   biosynthesis pathway, the substitution of the pyrophosphate
FT                   of 2-methyl-4-amino-5- hydroxymethylpyrimidine
FT                   pyrophosphate by 4-methyl-5- (beta-...; Region: TMP_TenI;
FT                   cd00564"
FT                   /db_xref="CDD:73367"
FT                   /locus_tag="Aboo_0116"
FT   misc_feature    complement(order(109259..109270,109322..109324,
FT                   109334..109336,109406..109408,109412..109414,
FT                   109433..109435,109439..109441,109490..109492,
FT                   109559..109561,109694..109696,109700..109702,
FT                   109772..109774,109778..109780))
FT                   /note="thiamine phosphate binding site; other site"
FT                   /db_xref="CDD:73367"
FT                   /locus_tag="Aboo_0116"
FT   misc_feature    complement(order(109259..109264,109322..109324,
FT                   109403..109408,109412..109414,109490..109492,
FT                   109544..109546,109601..109606,109688..109690,
FT                   109694..109696,109700..109702))
FT                   /note="active site"
FT                   /db_xref="CDD:73367"
FT                   /locus_tag="Aboo_0116"
FT   misc_feature    complement(order(109403..109405,109490..109492,
FT                   109544..109546,109553..109555,109601..109606,
FT                   109688..109690,109694..109696))
FT                   /note="pyrophosphate binding site; other site"
FT                   /db_xref="CDD:73367"
FT                   /locus_tag="Aboo_0116"
FT   gene            109888..111351
FT                   /db_xref="GeneID:8827053"
FT                   /locus_tag="Aboo_0117"
FT   CDS_pept        109888..111351
FT                   /locus_tag="Aboo_0117"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /codon_start="1"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /transl_table="11"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bsu:BSU14630 arginine decarboxylase"
FT                   /db_xref="GI:289595795"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:8827053"
FT                   /translation="MDNESQYDTPIADALNNLGGYIKWCTPSVLPHQKKISNIYKSDIS
FT                   VSAGFLGSYVDNTGIFKEAHDRAARVYGADRTLFSVNGTTGSNFIVLRMLTLEYESPQI
FT                   LVTRNIHHSILHAAEWLGIKFRFIKSSYDPQFESLIPPKPEDVLDTLNNYPESNAVIIS
FT                   SPTYSGLAAKLRDIVKVVKNFDKEIKVIVDEAWGSHFHFSDELPKSAMQAGADIAMQST
FT                   HKQGGSLQQTGMIHWKEKYVNSELMYEAFREYATTSPSYHLLASLDSVRAIMQKNGREL
FT                   VESLIKKAEYFKDLLGKKLIPPLKIMDDSLEFDLVKDYISGYDKTKTAIALTKFKETGF
FT                   ELGNLLSKSKIIVEKCSLNTILMLTTYSLSYSEIEKTVRALSSIIKNFHKTTKKNLIPN
FT                   PFQHLETKPVIEPHTARRVAQTIGRIVPLKDAIGKIAAEHIEIYPPGVPVILEGFRITE
FT                   NNVKYLLNVKEMGGHISARDPSLKTIYVL"
FT                   /protein_id="YP_003482491.1"
FT   misc_feature    109888..111342
FT                   /note="Arginine/lysine/ornithine decarboxylases [Amino acid
FT                   transport and metabolism]; Region: LdcC; COG1982"
FT                   /db_xref="CDD:32165"
FT                   /locus_tag="Aboo_0117"
FT   misc_feature    109915..110763
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176816"
FT                   /locus_tag="Aboo_0117"
FT   misc_feature    order(110137..110142,110149..110151,110374..110376,
FT                   110464..110466,110473..110475,110548..110550,
FT                   110557..110559)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Aboo_0117"
FT   misc_feature    110557..110559
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Aboo_0117"
FT   misc_feature    <111163..111306
FT                   /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
FT                   Region: OKR_DC_1_C; pfam03711"
FT                   /db_xref="CDD:112521"
FT                   /locus_tag="Aboo_0117"
FT   gene            111425..111724
FT                   /db_xref="GeneID:8827054"
FT                   /locus_tag="Aboo_0118"
FT   CDS_pept        111425..111724
FT                   /locus_tag="Aboo_0118"
FT                   /gene_family="HOG000063531" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01883"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF59"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   pfu:PF0288 hypothetical protein"
FT                   /db_xref="GI:289595796"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="GeneID:8827054"
FT                   /translation="MVKEEDVWNALRDVVDPEIGANLVDLGLIYEVRVDNGKDVYVKMT
FT                   LTVPGCPLMNVLPAQVEERLKQLDGVGKITVQLTFDPPWSPDRMSEELRKLYGW"
FT                   /protein_id="YP_003482492.1"
FT   misc_feature    111434..111706
FT                   /note="Domain of unknown function DUF59; Region: DUF59;
FT                   cl00941"
FT                   /db_xref="CDD:176589"
FT                   /locus_tag="Aboo_0118"
FT   gene            111762..112337
FT                   /db_xref="GeneID:8827055"
FT                   /locus_tag="Aboo_0119"
FT   CDS_pept        111762..112337
FT                   /locus_tag="Aboo_0119"
FT                   /gene_family="HOG000196501" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /codon_start="1"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tko:TK2143 uracil-DNA glycosylase; TIGRFAM:
FT                   phage SPO1 DNA polymerase-related protein; PFAM: Uracil-DNA
FT                   glycosylase superfamily"
FT                   /db_xref="GI:289595797"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="GeneID:8827055"
FT                   /translation="MQTTLYNFGDSLEKIEKEIKECKKCPLYKTRKNAVPGEGGFQRRI
FT                   MFVGEAPGRREDELGRPFVGAAGKFLDELLASIGLSRKDVYITNIVKCRPPGNRDPTDE
FT                   EIKLCSPYLDRQIAIMKPRIICPLGRFSAKYILEKFGFEMGKISKIQGKVFEGNILILP
FT                   MYHPAAALYHQNLKSELYKSFEVLKSLL"
FT                   /protein_id="YP_003482493.1"
FT   misc_feature    111837..112334
FT                   /note="Uracil DNA glycosylase superfamily; Region: UDG;
FT                   cl00483"
FT                   /db_xref="CDD:174234"
FT                   /locus_tag="Aboo_0119"
FT   gene            112401..117107
FT                   /db_xref="GeneID:8827056"
FT                   /locus_tag="Aboo_0120"
FT   CDS_pept        112401..117107
FT                   /locus_tag="Aboo_0120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   GAF domain protein; KEGG: cts:Ctha_2310 PAS/PAC sensor
FT                   hybrid histidine kinase; SMART: ATP-binding region ATPase
FT                   domain protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; histidine kinase A domain
FT                   protein; GAF domain protein"
FT                   /db_xref="GI:289595798"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:8827056"
FT                   /translation="MQVKCDELANAVKIGIVILDKNFKIVDANREILIKGNIKKEKLLN
FT                   TPFLLWFPEKMRGEIEKILQDVWNEKIEWGRGSYELYPMGSDKPLMVDVRVRKLKDSLV
FT                   VTIIDKSWLYKTLEKLNIVQSAVDNMAEGLVVTDINGTILFVNPGFTKMTGYSEEEAIG
FT                   KNPRILKSGKQDRKFYENLWNTILSGRIWKGSLINRRKDGTLYWEEMTIVPVKDNRGKI
FT                   TNFVAVKRDVSERKKLEEEVRKKEEYYRKIFNMSNDGIFIETLDGKIVDLNEAAAKMLG
FT                   YKRDELLKAGIDAIVTEEYKGKIKSIIEKLKKEGYARLEVFDRHKDGHLVPMELSISTL
FT                   HIDGEHLALVIARDLSFREEQETKYRILSEMASDAVILIKEDGIVEYWNPASQKIFGYT
FT                   SDEALNKPFWELIVPKKYLPGTNFQNLVKKGFEKASLPYTRRFEVQAKRKDGKLIDVEL
FT                   GISIFNISGKKYALAVIRDISERVEMERKLKKQTDELKAIYRFSLELGSIIDLPTLSQK
FT                   VYEEIKKLINFDSFSLGIVDWNKNTVRFDILTSGEKNLGPKEIEIDPENSLSSWVITSK
FT                   SALLIKNFEKEKDKLPAKWIKVGKMPKSWLGVPLMYKGKVLGIIVLQSFKPYQYDENDR
FT                   DFIMTLAAQLSIIIANAQLYNELKINEERYRGIVDSSIVGISVADISGILTFVNDKFAD
FT                   MLGYKKEELIGKSILEMTTEDGRKVFKKMLDRRKEGLIDYYENVLVRKDGKIIYALINA
FT                   SPLRDANGNIIGSTAVIVDITERKKEMEELKRKNAVLSALYNISLKMGEAPNLEEIFKI
FT                   TYKELYDIFNFDWFFIALCENNMLNYVILKSRNKSIVNYKLECNSEHSLAARAVKEGKP
FT                   LLFRDLPKEVKEENYTLIEGTEEVPTRSVIIFPLLYKNERLGVISIQSKRPNVYNENDV
FT                   KYVSTIAHAISIFIKNIQLYRQIKSTKEKLEKIVNSSLVGIDTTDLDGNVTFVNDALAE
FT                   MLGYRKEELIGKNILEVTTPKGKEILKHMLERRRKGFKDYYENELIRKDGKIIHALINA
FT                   APLRDENGKIVGTLGIVLDITKRKEMEEKIKNERERYKHLFESMANIIVLIQNERVIYI
FT                   NKQFEAATGYQKDEVLNKPFIDFVHPDMRDIVLSNYKRRMRGLEAPDHYIIKLIGKKGK
FT                   EIWMDIRTSVITWEHGKADLVSMMDITEIKEMEDKLITLDEIARKLKMAKSKDEIYEIA
FT                   IQNLYRVLNLYNSAILEIKDHTLVIVKSRGYVNPNIKLDVESERGITAWVARNNLPYYS
FT                   PNTDEDPLYITGVRGAKCEYATPISIDDEVYGVLDVQKDEPYSISEDDMKLIDLLANNM
FT                   AVALRSLEIQKDLEKAKNLQELMLHIVSHDLKNPLAVIEGYIDLMKEGFDPSYLDAMQM
FT                   AVEEASSIIEKARLFSKLGAGKIDEERKLIDLKEELENVSSLLSHKYPSGKINISVDKI
FT                   EIYAFPIIKEVFTNIIDNAFKYGAKNVDISLIDKDENVEIRIADDGPGIPKELRNTIFN
FT                   TFETLSKKKGSGLGLSIVKMIVEMHDGKVWVEENKPKGSVFVIQLPKD"
FT                   /protein_id="YP_003482494.1"
FT   misc_feature    112767..113096
FT                   /note="PAS fold; Region: PAS; pfam00989"
FT                   /db_xref="CDD:144544"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    112788..113096
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(112836..112838,112848..112850,112866..112868,
FT                   112905..112916,112992..112994,113007..113009)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(112896..112898,112908..112910,112932..112934,
FT                   112941..112946,113028..113030,113034..113036)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    113154..113486
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    113154..>113264
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    113481..113864
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    113514..113834
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(113562..113564,113574..113576,113592..113594,
FT                   113631..113642,113736..113738,113751..113753)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(113622..113624,113634..113636,113667..113669,
FT                   113676..113681,113772..113774,113778..113780)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    113928..114377
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    114381..114722
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    114414..114719
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(114462..114464,114474..114476,114492..114494,
FT                   114531..114542,114615..114617,114630..114632)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(114522..114524,114534..114536,114558..114560,
FT                   114567..114572,114651..114653,114657..114659)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    114813..115262
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    115272..115634
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    115305..115604
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(115347..115349,115359..115361,115377..115379,
FT                   115416..115427,115500..115502,115515..115517)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(115407..115409,115419..115421,115443..115445,
FT                   115452..115457,115536..115538,115542..115544)
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    115641..116006
FT                   /note="PAS domain S-box; Region: sensory_box; TIGR00229"
FT                   /db_xref="CDD:161776"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    115647..115844
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cl02459"
FT                   /db_xref="CDD:141436"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    116055..116441
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    116100..117098
FT                   /note="Signal transduction histidine kinase, nitrogen
FT                   specific [Signal transduction mechanisms]; Region: NtrB;
FT                   COG3852"
FT                   /db_xref="CDD:33642"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    116487..116669
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cl00080"
FT                   /db_xref="CDD:153499"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    116805..117095
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(116823..116825,116835..116837,116844..116846,
FT                   116907..116909,116913..116915,116919..116921,
FT                   116925..116930,116994..117005,117051..117053,
FT                   117057..117059,117072..117077,117081..117083)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    116835..116837
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aboo_0120"
FT   misc_feature    order(116919..116921,116925..116927,116994..116996,
FT                   117000..117002)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Aboo_0120"
FT   gene            117110..118045
FT                   /db_xref="GeneID:8827057"
FT                   /locus_tag="Aboo_0121"
FT   CDS_pept        117110..118045
FT                   /locus_tag="Aboo_0121"
FT                   /gene_family="HOG000222903" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /codon_start="1"
FT                   /product="protein of unknown function Met10"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function Met10; KEGG:
FT                   tsi:TSIB_1461 Met-10+ like protein"
FT                   /db_xref="GI:289595799"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="GeneID:8827057"
FT                   /translation="MRAPCIKVPLSEAEKTKRELAKMDALANLKWKKRDRYVIIPLKRE
FT                   LENLEICYEDFEEKRGREKIGSFDIIGDIAIVKYKEDLDYEELAKKLVDGKSIKKLAVD
FT                   MGVRGTERIRELKLIVGDSLETIHKEYGVRLKVDISKVYFSPRLATERWRVVQKVKDGE
FT                   TIFDMFAGCGPFSILIAKYKKVKIYACDINPYAIEYLEENIKMNKVKGITPILGDARDV
FT                   AKEIKADRIIMNLPHSSFEFLEYAIEAAKNGAFIHYYEILPKNNEREKDIIAKGDEVGA
FT                   RVKILEKRRVHAYSPSKDMFAFLLQIFKFI"
FT                   /protein_id="YP_003482495.1"
FT   misc_feature    117110..118036
FT                   /note="Predicted methyltransferase [General function
FT                   prediction only]; Region: COG2520"
FT                   /db_xref="CDD:32590"
FT                   /locus_tag="Aboo_0121"
FT   misc_feature    117599..117883
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Aboo_0121"
FT   misc_feature    order(117611..117631,117680..117685,117758..117766,
FT                   117809..117811)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Aboo_0121"
FT   gene            complement(118038..119981)
FT                   /db_xref="GeneID:8827058"
FT                   /locus_tag="Aboo_0122"
FT   CDS_pept        complement(118038..119981)
FT                   /locus_tag="Aboo_0122"
FT                   /gene_family="HOG000223261" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03675"
FT                   /codon_start="1"
FT                   /product="KH-domain/beta-lactamase-domain protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: KH-domain/beta-lactamase-domain protein;
FT                   PFAM: RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   tvo:TVN0664 metal-dependent RNase; SMART: beta-lactamase
FT                   domain protein; KH domain protein"
FT                   /db_xref="GI:289595800"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="GeneID:8827058"
FT                   /translation="MPWEDVLKQVREVMDELAPQAEITNIDLEGPLVVVYTRDMEFFAD
FT                   HPDIIKKVAQTVRRRIFIRPDPSLLMDEAQAKDEILNIVPEEAGIRDIYFVPETGEVVI
FT                   EAESPGAVIGKDGQLLNEIKKRIRWAPRVVRAPPLESRIVKEMRAYLKLVREERREILR
FT                   NIGKRINRPPLSGEQWVRVEALGGYREVGRSATLIMTRTSRVLVDCGLNVAVSDKADPW
FT                   SGAPYLYVPEVWDASDPEKPFKHIDAVVVTHAHLDHVGLVPLLFKYNYDGPVYMTAPTR
FT                   DLAAMLLIDYVKVAQSEGKKVPYESKHIKEMIKHTITLKYGETTDIAPDIRLTFHNAGH
FT                   ILGSSVSHFHIGEGLYNIVITGDIKYERSWLFNAAHNRFPRVETVIMESTYGGREDFQP
FT                   SRREAAERLKDVVMRTYDKGGKILIPVFAVGRSQEVMLVLESFMRNGELPEMPIYLDGM
FT                   IWEATTIHAAYPEYLNKDLRELIFQKKENPFLSPIFHRVESVERREEVISSSDPLIVLS
FT                   TSGMMNGGPVLEYFKHWADDPRNTLVFVGYQAVGTLGRRIQNGLKEVLMSLGGKPFTVK
FT                   VEMNIETIDGFSGHSDRRQLVQYISSMNPKPERVIICHGEENKCIDLAIGLHKRYGMET
FT                   MALKNLEVVRLR"
FT                   /protein_id="YP_003482496.1"
FT   misc_feature    complement(118041..119963)
FT                   /note="arCOG00543 universal archaeal
FT                   KH-domain/beta-lactamase-domain protein; Region:
FT                   arCOG00543; TIGR03675"
FT                   /db_xref="CDD:132714"
FT                   /locus_tag="Aboo_0122"
FT   misc_feature    complement(119481..119915)
FT                   /note="The archaeal cleavage and polyadenylation
FT                   specificity factor (CPSF) contains an N-terminal K homology
FT                   RNA-binding domain (KH).  The archeal CPSFs are predicted
FT                   to be metal-dependent RNases belonging to the beta-CASP
FT                   family, a subgroup enzymes within...; Region:
FT                   archeal_CPSF_KH; cd02410"
FT                   /db_xref="CDD:48408"
FT                   /locus_tag="Aboo_0122"
FT   misc_feature    complement(119631..119642)
FT                   /note="G-X-X-G motif; other site"
FT                   /db_xref="CDD:48408"
FT                   /locus_tag="Aboo_0122"
FT   misc_feature    complement(118869..119417)
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:174207"
FT                   /locus_tag="Aboo_0122"
FT   misc_feature    complement(118311..118688)
FT                   /note="Beta-Casp domain; Region: Beta-Casp; pfam10996"
FT                   /db_xref="CDD:151443"
FT                   /locus_tag="Aboo_0122"
FT   misc_feature    complement(118128..118262)
FT                   /note="RNA-metabolising metallo-beta-lactamase; Region:
FT                   RMMBL; pfam07521"
FT                   /db_xref="CDD:148882"
FT                   /locus_tag="Aboo_0122"
FT   gene            complement(119986..120618)
FT                   /db_xref="GeneID:8827059"
FT                   /locus_tag="Aboo_0123"
FT   CDS_pept        complement(119986..120618)
FT                   /locus_tag="Aboo_0123"
FT                   /gene_family="HOG000091083" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03634"
FT                   /codon_start="1"
FT                   /EC_number="3.4.25.1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: proteasome endopeptidase complex, beta
FT                   subunit; KEGG: pto:PTO0686 proteasome beta subunit; PFAM:
FT                   20S proteasome A and B subunits"
FT                   /db_xref="GI:289595801"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="GeneID:8827059"
FT                   /translation="MENAKTGTTTVGIVTKDGVVMGTEHRASMETFIAHKTAQKLYKLD
FT                   YNIGMTTAGLVGDLQVLVRYMRAEINLYRIRRKMYMPVGAAATLLSNILNERKFFPYYV
FT                   GLLVGGFDSKGYHVFAIDAAGGAIEDKYASVGSGSLFVYGVLEDRWKDDLSLDEGINLV
FT                   IRGINAAMRRDAASGDGISVATITKDEGFVELSQEEVEKRMKKLKLK"
FT                   /product="proteasome endopeptidase complex, beta subunit"
FT                   /protein_id="YP_003482497.1"
FT   misc_feature    complement(120031..120558)
FT                   /note="Archeal proteasome, beta subunit. The 20S
FT                   proteasome, multisubunit proteolytic complex, is the
FT                   central enzyme for non-lysosomal protein degradation in
FT                   both the cytosol and the nucleus. It is composed of 28
FT                   subunits arranged as four homoheptameric rings...; Region:
FT                   proteasome_beta_archeal; cd03764"
FT                   /db_xref="CDD:48462"
FT                   /locus_tag="Aboo_0123"
FT   misc_feature    complement(order(120085..120090,120097..120099,
FT                   120208..120210,120499..120501,120541..120543,
FT                   120547..120549))
FT                   /note="active site"
FT                   /db_xref="CDD:48462"
FT                   /locus_tag="Aboo_0123"
FT   misc_feature    complement(order(120082..120087,120094..120105,
FT                   120124..120126,120172..120180,120187..120192,
FT                   120196..120201,120223..120225,120232..120243,
FT                   120247..120249,120253..120255,120334..120336,
FT                   120343..120348,120352..120357,120364..120366,
FT                   120400..120402,120445..120447,120451..120453,
FT                   120532..120534,120541..120543))
FT                   /note="beta subunit interaction site; other site"
FT                   /db_xref="CDD:48462"
FT                   /locus_tag="Aboo_0123"
FT   gene            complement(120682..121479)
FT                   /db_xref="GeneID:8827060"
FT                   /locus_tag="Aboo_0124"
FT   CDS_pept        complement(120682..121479)
FT                   /locus_tag="Aboo_0124"
FT                   /gene_family="HOG000073589" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /codon_start="1"
FT                   /product="ABC-3 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-3 protein; KEGG: afu:AF1981 ABC
FT                   transporter, permease protein"
FT                   /db_xref="GI:289595802"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="GeneID:8827060"
FT                   /translation="MFTIDVWLLRAIIAIFLIAIVSSLIGSYSVFRGSTFLVSGIAHGA
FT                   LAGAALGIFLALYLFSVNYLLVALIFSILFALAIGYASHKKENVDVSVGVMFALSMSLA
FT                   ILFLSLIREYASVAWGLIIGDLLLLSQTDIEIMTLSVIAIVLIFIIYHRRILFSIFDPE
FT                   GAMAVGLKPALYESLLYVIVAIGVVVLLKGVGAILVYALLIIPAAASKRISSTVSITML
FT                   FAFLISLFSGLGGLALAVISPVSPSAYAGLIATSIYFLTIFKK"
FT                   /protein_id="YP_003482498.1"
FT   misc_feature    complement(120817..121302)
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cl00462"
FT                   /db_xref="CDD:176819"
FT                   /locus_tag="Aboo_0124"
FT   misc_feature    complement(order(120883..120885,121111..121113,
FT                   121120..121125,121153..121155,121159..121164,
FT                   121171..121173,121180..121185,121192..121197,
FT                   121204..121209,121213..121215))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Aboo_0124"
FT   misc_feature    complement(order(120895..120897,120907..120909,
FT                   121081..121083,121153..121155))
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Aboo_0124"
FT   misc_feature    complement(order(120829..120831,120850..120852,
FT                   120976..120984,120988..121005,121009..121014,
FT                   121018..121026,121030..121035))
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Aboo_0124"
FT   gene            complement(121466..122218)
FT                   /db_xref="GeneID:8827061"
FT                   /locus_tag="Aboo_0125"
FT   CDS_pept        complement(121466..122218)
FT                   /locus_tag="Aboo_0125"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tsi:TSIB_0411 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:289595803"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:8827061"
FT                   /translation="MIEIQNLSVKYDSQIALENINLKLEHPSLLVIMGPNGAGKTTLLK
FT                   SILGLVEYEGKIKIFGKEPEESRNIIGYMPQRDRVNTNIPLKVKDVVLMPLLSRYYFGI
FT                   RLEDVKNAKRALERVGMLHYWDKNFSSLSGGEQQRVFLARVLAQSSKILILDEPFSATD
FT                   VATKMKMAGILHKLKREKTIIIVTHDVNPLVECTDKLLLLRKRVIAFGDVMDVLNEENM
FT                   EKLYGVKVPIVRRENVCYVLGGDVHVHH"
FT                   /protein_id="YP_003482499.1"
FT   misc_feature    complement(121538..122218)
FT                   /note="ABC-type Mn/Zn transport systems, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: ZnuC;
FT                   COG1121"
FT                   /db_xref="CDD:31318"
FT                   /locus_tag="Aboo_0125"
FT   misc_feature    complement(121586..122212)
FT                   /note="ABC component of the metal-type transporters.  This
FT                   family includes transporters involved in the uptake of
FT                   various metallic cations such as iron, manganese, and zinc.
FT                   The ATPases of this group of transporters are very similar
FT                   to members of iron-...; Region: ABC_Metallic_Cations;
FT                   cd03235"
FT                   /db_xref="CDD:72994"
FT                   /locus_tag="Aboo_0125"
FT   gene            complement(122215..122622)
FT                   /db_xref="GeneID:8827062"
FT                   /locus_tag="Aboo_0126"
FT   CDS_pept        complement(122215..122622)
FT                   /locus_tag="Aboo_0126"
FT                   /gene_family="HOG000271069" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01325"
FT                   /codon_start="1"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /transl_table="11"
FT                   /note="KEGG: tvo:TVN0945 metal-dependent transcription
FT                   regulator; PFAM: iron dependent repressor; SMART: iron
FT                   dependent repressor"
FT                   /db_xref="GI:289595804"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="GeneID:8827062"
FT                   /translation="MITEVEGKYIMAIYEAQMNGIVGIGPKKMAEIMNVKRPTAYEVLN
FT                   KLAGMGYLKKDMGKYTLTEEGMALARRVVRNHRIIETMLYRMGIEADRACTIASRIQVN
FT                   IEDDVVELICNRLGNPKECPHGRPIPEGVDK"
FT                   /protein_id="YP_003482500.1"
FT   misc_feature    complement(122461..122598)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Aboo_0126"
FT   misc_feature    complement(122269..122550)
FT                   /note="Helix-turn-helix diphteria tox regulatory element;
FT                   Region: HTH_DTXR; smart00529"
FT                   /db_xref="CDD:128802"
FT                   /locus_tag="Aboo_0126"
FT   misc_feature    complement(122227..122436)
FT                   /note="Iron dependent repressor, metal binding and
FT                   dimerization domain; Region: Fe_dep_repr_C; pfam02742"
FT                   /db_xref="CDD:145737"
FT                   /locus_tag="Aboo_0126"
FT   gene            122700..124154
FT                   /db_xref="GeneID:8827063"
FT                   /locus_tag="Aboo_0127"
FT   CDS_pept        122700..124154
FT                   /locus_tag="Aboo_0127"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /codon_start="1"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /transl_table="11"
FT                   /note="KEGG: tpe:Tpen_1027 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="GI:289595805"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:8827063"
FT                   /translation="MRYAKLLVLIYAFIFVTSIIYAVNFNPSEGGEVKNLSTSSNELFV
FT                   VPIENYGYAPMLKHLIDNATESVYVSMEILSDYEPVKTLLDSLIAAHNRGVDVKVICEG
FT                   DISSNKYGVQYLENGGVEVKVDNTQKFIHTKMVVIDGKVVYVGSHNWSPYALGKNNEYG
FT                   ILIFNSQIADFYQNYFDSLWKDSSKIPQLSCISQSDGELSVKTTYDGYTYNALKDLINS
FT                   AKHRLYISVYTMAYYSNPEGNETLVNNLVNEIIEKRDIAKVVLDDHDSDNAYNYLQDNY
FT                   VSVEYDSSSVTTHLKLVIADDTVYVGDANWDYGYLDNETHTVGVIIENKTVADFFANYF
FT                   LQIWKYKDNPYYIPDGFVDKWSFTASPGEELDINLFLANGGYKNDSSFYLIPGGNLNAS
FT                   LNENLEWYRENVYDWRNETMKVEIPDNASGYYTVHITLYGQDKYINYTIYFTIYVENSV
FT                   PEFESFTPLIIAFTIIFAILIKKKDD"
FT                   /protein_id="YP_003482501.1"
FT   misc_feature    122793..123257
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aboo_0127"
FT   misc_feature    order(123096..123098,123102..123104,123141..123143,
FT                   123147..123149,123180..123182)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aboo_0127"
FT   misc_feature    order(123096..123098,123102..123104,123117..123119,
FT                   123138..123143,123147..123149)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aboo_0127"
FT   misc_feature    123333..123752
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aboo_0127"
FT   misc_feature    order(123579..123581,123585..123587,123621..123623,
FT                   123627..123629,123660..123662)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aboo_0127"
FT   misc_feature    order(123579..123581,123585..123587,123600..123602,
FT                   123618..123623,123627..123629)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="Aboo_0127"
FT   gene            complement(124151..124642)
FT                   /db_xref="GeneID:8827064"
FT                   /locus_tag="Aboo_0128"
FT   CDS_pept        complement(124151..124642)
FT                   /locus_tag="Aboo_0128"
FT                   /gene_family="HOG000222940" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02087"
FT                   /codon_start="1"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: pfu:PF0939 3-isopropylmalate dehydratase small
FT                   subunit; TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="GI:289595806"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="GeneID:8827064"
FT                   /translation="MGRVWKYGDDVNTDVIFPGKYTYKIMSDEEMASHALEDLDPEFAK
FT                   NVKPGDVIVAGKNWGYGSSREQAVKCLKAAGIKAIIAESFARIYYRNCINLGLPAITLK
FT                   REEIEKFEAGDKVEVDIENGIIINKTKGFEVHFPPFEGYVMDIIKAGGIIEYIRKNREN
FT                   "
FT                   /protein_id="YP_003482502.1"
FT   misc_feature    complement(124283..124627)
FT                   /note="Aconatase-like swivel domain of 3-isopropylmalate
FT                   dehydratase and related uncharacterized proteins.
FT                   3-isopropylmalate dehydratase catalyzes the isomerization
FT                   between 2-isopropylmalate and 3-isopropylmalate, via the
FT                   formation of 2-isopropylmaleate 3-...; Region: IPMI_Swivel;
FT                   cd01577"
FT                   /db_xref="CDD:73275"
FT                   /locus_tag="Aboo_0128"
FT   misc_feature    complement(124448..124456)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73275"
FT                   /locus_tag="Aboo_0128"
FT   gene            complement(124643..125899)
FT                   /db_xref="GeneID:8827065"
FT                   /locus_tag="Aboo_0129"
FT   CDS_pept        complement(124643..125899)
FT                   /locus_tag="Aboo_0129"
FT                   /gene_family="HOG000226971" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01343"
FT                   /codon_start="1"
FT                   /product="homoaconitate hydratase family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mka:MK1440 3-isopropylmalate dehydratase large
FT                   subunit; TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein"
FT                   /db_xref="GI:289595807"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="GeneID:8827065"
FT                   /translation="MGMTLTEKILAKKAGKKEVQPGEIVTVEPTWVMSHDNSAAILLKF
FT                   KKTGVKKVWNPKKIVIILDHTVPAPTADYANNHKSIREFVKEQGIENFWDINTGICHQV
FT                   MAEKGYDLPGAVIVGADSHTTTPGAFGAFAAGIGRSEVAAIWATGKIWLRVPESYEIIV
FT                   NGKLPKGVFAKDLALHIVGDVTASGAVYKAVEFKGETIKDMTIASRMVLTNMSAEMGAK
FT                   NGIIEADEKTEAYLKTRARAPYEIMHPDEDAEYERRYEYDASDLVPKIAFPHTVDNVYD
FT                   IDKAEGIEVNQVFLGTCTNGRVEDLEIAARILKGKKVNKNVRMLVFPASWDVWREADEK
FT                   GILRTLAEAGAVIMNPGCGPCLGAHAGVLADGEKCLSTANRNFKGRMGNPNAEIYLGSP
FT                   ATAAATALKGYIADPREVL"
FT                   /protein_id="YP_003482503.1"
FT   misc_feature    complement(124646..125899)
FT                   /note="3-isopropylmalate dehydratase large subunit;
FT                   Reviewed; Region: PRK00402"
FT                   /db_xref="CDD:166941"
FT                   /locus_tag="Aboo_0129"
FT   misc_feature    complement(124667..125809)
FT                   /note="3-isopropylmalate dehydratase catalyzes the
FT                   isomerization between 2-isopropylmalate and
FT                   3-isopropylmalate; Region: IPMI; cd01583"
FT                   /db_xref="CDD:153133"
FT                   /locus_tag="Aboo_0129"
FT   misc_feature    complement(order(124742..124744,124757..124759,
FT                   124814..124816,125534..125539,125786..125788,
FT                   125795..125797))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:153133"
FT                   /locus_tag="Aboo_0129"
FT   misc_feature    complement(order(124760..124762,124814..124819,
FT                   124826..124828,125006..125008,125531..125533))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:153133"
FT                   /locus_tag="Aboo_0129"
FT   gene            125958..126443
FT                   /db_xref="GeneID:8827066"
FT                   /locus_tag="Aboo_0130"
FT   CDS_pept        125958..126443
FT                   /locus_tag="Aboo_0130"
FT                   /gene_family="HOG000223294" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00670"
FT                   /codon_start="1"
FT                   /product="Nucleotide binding protein PINc"
FT                   /transl_table="11"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   pto:PTO0520 hypothetical protein"
FT                   /db_xref="GI:289595808"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="GeneID:8827066"
FT                   /translation="MMMQCSAVERLVLDSSALIEGFVPPANYEIYIPPGVAEEVRDKSL
FT                   DFTLLKIVSPSRYNTKLAVKAAKETGDFPSLSNVDIEVIALAIQLNAKIVTDDYAIQNV
FT                   ASHLGLDFEGVHQEKIKEKRKWKWRCTSCGRYFNHYYEQCPVCGGELKRVKSSGKKL"
FT                   /protein_id="YP_003482504.1"
FT   misc_feature    125988..126416
FT                   /note="hypothetical protein; Provisional; Region: PRK12496"
FT                   /db_xref="CDD:171543"
FT                   /locus_tag="Aboo_0130"
FT   misc_feature    125991..126272
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:175014"
FT                   /locus_tag="Aboo_0130"
FT   gene            complement(126580..127722)
FT                   /db_xref="GeneID:8827067"
FT                   /locus_tag="Aboo_0131"
FT   CDS_pept        complement(126580..127722)
FT                   /locus_tag="Aboo_0131"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /codon_start="1"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /transl_table="11"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: neq:NEQ362 hypothetical protein"
FT                   /db_xref="GI:289595809"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="GeneID:8827067"
FT                   /translation="MDYEERLKIAKKWADLVVEKYGEMIKSIVLFGSLSRGVVSSKSDI
FT                   DVVVIVDDPKQLPTGFLESMDNELERIKDEIDGHLLEIHPTYTLTEFWDNARMGNPVIY
FT                   NIIKEGVALYDVGVFEPLQQLWLKGKIPHTKEAVDMQMKRAMEKIERAEVVKIMQIAED
FT                   CYYAIIDSAQALFMALGEDAPQPKKLYGEMMKNLVAPGILESQYAEWVKEIVELRDKIK
FT                   RREIKEIKGEDVDLWIDRAKKIVGKMEELIEIKELGELSKIVLRTLEIMAKAVVEGLIK
FT                   LGKEVPGYIIELAKIESTKEFIEKYEEIKIDELKREFKNAFIDSRKLDEGYMLVWNRLE
FT                   ELKNDIENKNFEKVERSEVLALREAVREMIRKIDKNTQKV"
FT                   /protein_id="YP_003482505.1"
FT   gene            127831..130323
FT                   /db_xref="GeneID:8827068"
FT                   /locus_tag="Aboo_0132"
FT   CDS_pept        127831..130323
FT                   /locus_tag="Aboo_0132"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: iho:Igni_0981 hypothetical protein"
FT                   /db_xref="GI:289595810"
FT                   /db_xref="GeneID:8827068"
FT                   /translation="MSSELLSVIQDARRRVLEDMSFVERVKAFFAPEILGEEVAQELKN
FT                   MGLEEFVREQYRSVEREEYERIRAKAEYEFWRDFEMEKIKNDIAKYLSSAVLTNKRLLG
FT                   FFPIYDFVPSIDDIFDMLVEEHGDDVERALREMEKNVSGENKKKVQVAKKKVRRRSKGR
FT                   RRKIIYALLSAGLMIGAAVGMYYYEKYVKDSDHDGIPDWFEIHKYHTNPNKADTDGDGL
FT                   TDYQEIFQYHTNPLVKDTDHDGINDGLEVQLHMNPLKPTLFNETGIQEVFSDQMVKDIK
FT                   AIGTIWIPSFGFKSAYWANSTVTVSYGNGYKYTLPIKDSLTGARLIPTFIWNAGRYKNS
FT                   YYDPRFSPYSTLLYLNDMTHNLGNNITKLNHDSKKFSSELQTLENSLINITKNPNDNQS
FT                   FERANKILMKYKPQQNEDMWYDEYWFFEPINNKFRNYLREFNNNSTDRINDLEKALFIL
FT                   NGDKQIASTISNTTPYVSLMLDFMNEYKKIVKKMPHSEENVKINWWTNEGMHLWSIESA
FT                   MGMVTMNILDYPETLIEALFMMNGQIFNNSKQNAKISSDLTPLNLPAPVEKYWTNFYDN
FT                   LSSLEKSNFKNWLRSYTNNRNSTGILDYLLIRDWVYKLLPTKNVYSTSNPKIVDYGFRL
FT                   TTTGIFDIDDKEDINFIRGLWKKVPNEAPSIDKVWNYTNEAGVALPRVGNIVFGPFTVE
FT                   KAQKLGKNDCATATAAMIEILMKYYPKYLPVAVIKTFPIITEKYKAIGIHNMPFFYHDG
FT                   NWYEMELWNGYNKPTTEIEDHLASNIDGWVTIPIAFGNAPVSVPLRDDRLLNIVKEYVP
FT                   DKIVSMMYYLRQNNIHDE"
FT                   /protein_id="YP_003482506.1"
FT   gene            130588..131976
FT                   /db_xref="GeneID:8827069"
FT                   /locus_tag="Aboo_0133"
FT   CDS_pept        130588..131976
FT                   /locus_tag="Aboo_0133"
FT                   /gene_family="HOG000101642" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03008"
FT                   /codon_start="1"
FT                   /product="DUF234 DEXX-box ATPase"
FT                   /transl_table="11"
FT                   /note="PFAM: DUF234 DEXX-box ATPase; ATPase; KEGG:
FT                   gme:Gmet_2667 DUF234 DEXX-box ATPase"
FT                   /db_xref="GI:289595811"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="GeneID:8827069"
FT                   /translation="MRFYDRQNELRTLERMYRLSKNAKHMLVVLGRRRIGKTRLIKEFI
FT                   RGKKSFYFFVERSSSAMLLQRISNELARMMPKKVVGTLDWELAFKILLEDFDVVVLDEF
FT                   QNILSVDESALSTLQHVWDEFNGSTLLILVGSYQTMMKKIFEDYRTPLYGRSSGRLRVE
FT                   PLSYRYVRRILLDMKFRGEENMMNIYSILGGVPLYYEFIERFGISGTWKDIVKAMFIEE
FT                   PRPLIDEPHVLLVGEFGRQQSTYMSILEAIARGKSTMTEIANATGIPEKSLGKYLKELS
FT                   QDYEIIERKVPMFSPPNSKRGRYFLRDPFLTFWFRFIYPNMSMIELGQGDELIRSIENN
FT                   VNAHMGRIFEKIVAEIIAEQFKPLKMGSWWNRRGDEIDIVAELENEVLFVECKWRNRKI
FT                   TWREVEDLIRKSELVKIEASKKRRYMIVSKSGFTENCRNRIDEKGIIYWDLSDLERAMK
FT                   VPNE"
FT                   /protein_id="YP_003482507.1"
FT   misc_feature    130588..131877
FT                   /note="Predicted ATPase (AAA+ superfamily) [General
FT                   function prediction only]; Region: COG1672"
FT                   /db_xref="CDD:31858"
FT                   /locus_tag="Aboo_0133"
FT   misc_feature    131527..131799
FT                   /note="Archaea bacterial proteins of unknown function;
FT                   Region: DUF234; pfam03008"
FT                   /db_xref="CDD:145908"
FT                   /locus_tag="Aboo_0133"
FT   gene            132701..132785
FT                   /note="tRNA-Leu1"
FT                   /db_xref="GeneID:8827070"
FT                   /locus_tag="Aboo_R0004"
FT   tRNA            132701..132785
FT                   /db_xref="GeneID:8827070"
FT                   /locus_tag="Aboo_R0004"
FT                   /product="tRNA-Leu"
FT   gene            complement(132859..137745)
FT                   /db_xref="GeneID:8827071"
FT                   /locus_tag="Aboo_0134"
FT   CDS_pept        complement(132859..137745)
FT                   /locus_tag="Aboo_0134"
FT                   /gene_family="HOG000073595" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /codon_start="1"
FT                   /product="Fibronectin type III domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mac:MA2507 cell surface protein; PFAM:
FT                   Fibronectin type III domain protein; periplasmic
FT                   copper-binding; SMART: Fibronectin type III domain protein;
FT                   peptidase C1A papain; Carbohydrate-binding and sugar
FT                   hydrolysis; Parallel beta-helix repeat"
FT                   /db_xref="GI:289595812"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="GeneID:8827071"
FT                   /translation="MVETKSSGVVKVLVISLLLLMIFSGFGVVMNVTGVSTYKISPTFN
FT                   EANVAKTHILDTSFSDFKFKKINQENINKMLELREKIMERLNESNGGKSYHSLPEYNME
FT                   NSAVRMEHLSYMNTRIDFKNNATPMIDGHATGLILPDKKELENLIGHKMIIGLNTKVKE
FT                   PSTVRWDLDPHFPPVGDQKWQGSCTAWAVSYYQNGFLQRMIYNWTDDSPAHLMSPSWTY
FT                   NKVNGGGDYGSSFEGNAELIESVGDATLANMTYNPSDYTSWGNESAWRDAPKHRIAGYY
FT                   LVYFGNDSGIETIKELLREGYLVTFAIDASQYYNGFVDGNYIISSQEYNSYGLNHAQTI
FT                   VGYDDNITDDGDVGAFRVVNSWGTGFGDHGFYWLTYKALEEKVSQGWPYAYVLVPISQH
FT                   SYNPKLLATWHFSNPGPRDASVNIALGFQNSNYYRTPIWDGGNYSFPSFMALDITEFYN
FT                   EWVNSSYQNKFYLKIGTSNSGSSIVDSFKIEYYPYGYKYLWQNSTESPDVPATTPMVIS
FT                   SSPFSPSEYFPYVHVSLVNGIAHIYTDSLEYPVWIGNAGNKSDAILITTQATNGWSVSL
FT                   PSKEELSAGVSIKVNMTIQLPTNAKLGDSSLITIKAVSENDTSKVYELEFNAYYVSRPI
FT                   HIESNTDFAQQAQKYGWPGDGSKSNPYVINNLYILGESAVGIYINSTDVYAVINGTHIE
FT                   NTQGGIYLEYSSNIVIKNSILKNIIGYGILLDSSSNNIISNNTCSNNWAGIKLSHSSNN
FT                   VISSNICNNNNDGIELWDFSNNNIIYNNNCSNNKARIKVWYNEGGIFLEYSSNNMISSN
FT                   TCISNERYGIYLQISSNNRLYENKLVNNGISLWGDIGAFTTQEIPTNNTVNGKPVYYFK
FT                   NVNMNNASVPSNAGEVILGNVTWLKIENLQIHNSTVAIEIGGSSHITIKNNNCSNNRHG
FT                   INLLYSSNNTISSNTCNNNGYGIGWWFSGIELWYSSNNVISNNICNGNGNGILDLSNNN
FT                   VISNNTCNHNQGEGIFVWYSSNNVISNNICNNNNDGIELWDFSNNNIIYNNTCNDNNRY
FT                   GIFLEYSSNSNIIHNNICNGNEISILLSDSSNNVISNNTFSNNWAGIELSYSSNNVISN
FT                   NLLTNNSGYYGIHIYSGSNWNHIYKNNFYYNDGSGSTFKSSYVQARDDGTNNHWNSTSG
FT                   IGNYWYDWANNNNTNDQNGDGIVDWPYKIDGSAGAKDYYPLRCPIGESTPSQPFNLTAK
FT                   TGDGYINLSWEQPVCNGSSDIIEYRIYRNGSLIATVQANQLWYNDSDVKNGVRYTYYVT
FT                   AVNSIGESQPSNEVQVTPMTVPNAPESLQAKAGNRYVNLSWEVPSDNGGSAITGYRVYR
FT                   NGSLIATVQANQLWYNDSDVKNGVRYTYYVTAVNSIGESQPSNEVQVTPMTVPNAPESL
FT                   QAKAGNRYVNLSWEVPSDNGGSAITGYRVYRNGSLIATVQANQLWYNDSDVKNGVRYTY
FT                   YVTAVNSIGESQPSNEVQVTPMTVPNAPESLQAKAGNRYVNLSWEVPSDNGGSAITGYR
FT                   VYRNGSLIATVQANQLWYNDSDVKNGVRYTYYVTAVNSIGESQPSNEVQVTIAQSGNNN
FT                   QSTNTQSNEYSGILNNPYYVWSIVLGLIITIVIIAVVMKKRNAGKKRRI"
FT                   /protein_id="YP_003482508.1"
FT   misc_feature    complement(136582..137229)
FT                   /note="C1 Peptidase family (MEROPS database nomenclature),
FT                   also referred to as the papain family; composed of two
FT                   subfamilies of cysteine peptidases (CPs), C1A (papain) and
FT                   C1B (bleomycin hydrolase). Papain-like enzymes are mostly
FT                   endopeptidases with some...; Region: Peptidase_C1; cd02619"
FT                   /db_xref="CDD:30293"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(136666..136668,136738..136740,
FT                   137185..137187,137203..137205))
FT                   /note="active site"
FT                   /db_xref="CDD:30293"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(135220..135354)
FT                   /note="parallel beta-helix repeat (two copies); Region:
FT                   para_beta_helix; TIGR03804"
FT                   /db_xref="CDD:163516"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(133843..134100)
FT                   /note="Fibronectin type 3 domain; One of three types of
FT                   internal repeats found in the plasma protein fibronectin.
FT                   Its tenth fibronectin type III repeat contains an RGD cell
FT                   recognition sequence in a flexible loop between 2 strands.
FT                   Approximately 2% of all...; Region: FN3; cd00063"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(133876..133878,133921..133923,
FT                   134098..134100))
FT                   /note="Interdomain contacts; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(133861..133866,133870..133875))
FT                   /note="Cytokine receptor motif; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(133573..133830)
FT                   /note="Fibronectin type 3 domain; One of three types of
FT                   internal repeats found in the plasma protein fibronectin.
FT                   Its tenth fibronectin type III repeat contains an RGD cell
FT                   recognition sequence in a flexible loop between 2 strands.
FT                   Approximately 2% of all...; Region: FN3; cd00063"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(133606..133608,133651..133653,
FT                   133828..133830))
FT                   /note="Interdomain contacts; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(133591..133596,133600..133605))
FT                   /note="Cytokine receptor motif; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(133303..133560)
FT                   /note="Fibronectin type 3 domain; One of three types of
FT                   internal repeats found in the plasma protein fibronectin.
FT                   Its tenth fibronectin type III repeat contains an RGD cell
FT                   recognition sequence in a flexible loop between 2 strands.
FT                   Approximately 2% of all...; Region: FN3; cd00063"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(133336..133338,133381..133383,
FT                   133558..133560))
FT                   /note="Interdomain contacts; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(133321..133326,133330..133335))
FT                   /note="Cytokine receptor motif; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(133033..133290)
FT                   /note="Fibronectin type 3 domain; One of three types of
FT                   internal repeats found in the plasma protein fibronectin.
FT                   Its tenth fibronectin type III repeat contains an RGD cell
FT                   recognition sequence in a flexible loop between 2 strands.
FT                   Approximately 2% of all...; Region: FN3; cd00063"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(133066..133068,133111..133113,
FT                   133288..133290))
FT                   /note="Interdomain contacts; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   misc_feature    complement(order(133051..133056,133060..133065))
FT                   /note="Cytokine receptor motif; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0134"
FT   gene            138386..139723
FT                   /db_xref="GeneID:8827072"
FT                   /locus_tag="Aboo_0135"
FT   CDS_pept        138386..139723
FT                   /locus_tag="Aboo_0135"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tsi:TSIB_2058 hypothetical protein"
FT                   /db_xref="GI:289595813"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="GeneID:8827072"
FT                   /translation="MMMNIIKYTLDYQELLILLAQALGLYTFDNSYKNKFITTKRLYDY
FT                   LKSVQTLMRENGVMLIIPSRKVVSNEMARLYRMGFLSRKAVPRKVKTKSGKIVNRGIEY
FT                   QYSFTKQGMKYLAYLIKNGSGSLPEELDPELEVILSKMRKEGEIKSYENEFELREMTKL
FT                   MWKIWFKEKDDGKIKVFTPKGWSPANKKLIKILDHEKLIKNINIEQAYEFRDENEKLKE
FT                   KIKELEEELEKKNKEIERLQGELKKCKEKKENKAFNMEQREIAAKRNYLISFDKKPVKK
FT                   SMDYFENTRKKLEKYKSKYAKDINKEPELTISMKISDDADSYEKASIMWAARLLSTLSL
FT                   EIKKSGIIIRWIKPQNFGKKVEYVIFKNGKEYARVSSDKEWFLDKDVQENESYEYYVRA
FT                   IVGNSYSDSPKIQVTYKKENEGVVYTPFDSHHSVEWSIHHPEDLDI"
FT                   /protein_id="YP_003482509.1"
FT   gene            complement(139850..140908)
FT                   /db_xref="GeneID:8827073"
FT                   /locus_tag="Aboo_0136"
FT   CDS_pept        complement(139850..140908)
FT                   /locus_tag="Aboo_0136"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mfe:Mefer_1243 hypothetical protein"
FT                   /db_xref="GI:289595814"
FT                   /db_xref="GeneID:8827073"
FT                   /translation="MRYIAIVVTLTLLFIPLSHAYSDNNEIAYNWSFYGQNFEVVININ
FT                   GSENSSLYHSFNFWVLNLTVPYDAYQFYRDYPAGYRIGDNLSYLSYFLTPNDTYIRELA
FT                   HMLDTIAKKNGWDRLTEANFILTFVQNVPYVSDFTSTGFVDYYKFPLETLFQKGGDCED
FT                   KSLLLATLLYILGYDVVLFAMEVQFQGLYGHVAVGLDVKNKTGPFARYLQYYYAYDGKD
FT                   YYYMESTGSQSMVISGGGIENVHYWVGISPEAAGAKIYNLTVIPLNGPHYEGYHQKYDY
FT                   VKEVKAQESFNWYLLYALGLLVLFLPLFVYAISKEKKRCPSCGYSVEDDFNYCPNCGYW
FT                   LKPPWPPKPPFS"
FT                   /protein_id="YP_003482510.1"
FT   sig_peptide     complement(140846..140908)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.965 at
FT                   residue 21"
FT                   /locus_tag="Aboo_0136"
FT   gene            complement(140905..141474)
FT                   /db_xref="GeneID:8827074"
FT                   /locus_tag="Aboo_0137"
FT   CDS_pept        complement(140905..141474)
FT                   /locus_tag="Aboo_0137"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpe:CPE0415 hypothetical protein"
FT                   /db_xref="GI:289595815"
FT                   /db_xref="GeneID:8827074"
FT                   /translation="MNAWKITALIVFIAGFTLVVLGGIYNPYTNVVDLPSGGFRGIGFN
FT                   MYAGEVVNYHLTSLERFTVYIMNSTEFHKLMNNGTFNGSYYTQTGKNMNLEFKAPQKDV
FT                   YYIVIANFNSQSSIEVDFVYRKGMSMPLFLGGSIIVAISIVVLLIDLYGSKQVNKNRVC
FT                   PGCGREVSEEWNYCPYCRYELRDDKK"
FT                   /protein_id="YP_003482511.1"
FT   sig_peptide     complement(141406..141474)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.845 at
FT                   residue 23"
FT                   /locus_tag="Aboo_0137"
FT   gene            complement(141757..142587)
FT                   /db_xref="GeneID:8827075"
FT                   /locus_tag="Aboo_0138"
FT   CDS_pept        complement(141757..142587)
FT                   /locus_tag="Aboo_0138"
FT                   /gene_family="HOG000073540" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   mpl:Mpal_2299 transposase IS4 family protein"
FT                   /db_xref="GI:289595816"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:8827075"
FT                   /translation="MSRKLELYKIVKIGLRAMKRAKLPLYWSKYSRKDYTLHQHIMLIV
FT                   LVQYAGSIERMLQIVREMRKIKRVMRLKKIPHKSTISRELRRIPERWIRIVLREIVKIM
FT                   GIPNKFAVDSTGIQIYYRSYYYTQRIGEVGKIREGLKLHAAVDIERKLITNAIVTKWHT
FT                   NDSPYLIPLLEEERVKEVYADKGYDSLRNIRFVLNKGGTPYIAIRNKARRGLRRRLLEK
FT                   SKSPDWKKKYSHRNVIESVFHSFKRVVGDYIFSHSFSGASKLLLFKVLAYDLYV"
FT                   /protein_id="YP_003482512.1"
FT   misc_feature    complement(141772..142260)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Aboo_0138"
FT   gene            142684..144618
FT                   /db_xref="GeneID:8827076"
FT                   /locus_tag="Aboo_0139"
FT   CDS_pept        142684..144618
FT                   /locus_tag="Aboo_0139"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ta0602"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tac:Ta0602 hypothetical protein"
FT                   /db_xref="GI:289595817"
FT                   /db_xref="GeneID:8827076"
FT                   /translation="MRRVKFGWKFYLMIITALAIAVRSIPSWIYSAWGTDFGIYYSITI
FT                   EFLIKKNPFYEYPAVWGSSGYGSFPMLYLIILGAHFLTGLPPQQLLLKIPPIIGGLTII
FT                   PLYMITYEITKDRKISLIASALLAINPIHVYQTSMPYLLTVGHFFLLLSLYFFIKWIKE
FT                   RKYLGFLIASSIALLLSHHLSNYMYIISITGISLIGGLYNYIPKKTVKRAFVFIISFTI
FT                   GTITYWILRVPGMKYFMSSPFHYALPWYGTATIGTILLLILYKIAITYNLNHSDKLWKK
FT                   INSLKIINVFALSLGLSITVFLILALVGLHGYYIPPIAIFYSIPFMLTIGFIGVGFVKL
FT                   KKHPESFYFVGSWLLSIIASLIVGLITWSSLEPWRHIEYMMEPLSIIGAIGIASILNSE
FT                   FFHKISVRKRVSVYFEGFSYTPHKIFGENTLEISNPIPIGGAKVVGDPITYEEKYPIGK
FT                   VFKTIFIFTITFIVLMSGISAFPFMNHVERSTQEGISPVIMSGIEWLNENGNRNYTVAT
FT                   NHMIGTILEAYGFPSSFEYDYEIWNATNWTDCIDELQGLNGTYPPIGYVLITKDMYENG
FT                   VFGYNNSQNPLQPPVFMGKEGYEKFHREPFKLIYRNATADNSNWVEIYTVDWHYINNYL
FT                   QSKKQAKSS"
FT                   /protein_id="YP_003482513.1"
FT   gene            complement(144821..148909)
FT                   /db_xref="GeneID:8827077"
FT                   /locus_tag="Aboo_0140"
FT   CDS_pept        complement(144821..148909)
FT                   /locus_tag="Aboo_0140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /codon_start="1"
FT                   /product="PKD domain containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0292 hypothetical protein; PFAM: PKD
FT                   domain containing protein; SMART: PKD domain containing
FT                   protein"
FT                   /db_xref="GI:289595818"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="GeneID:8827077"
FT                   /translation="MKVETKRILLAVLVISLVLVSGFSVMTGNASAQTNTSSQVKSSGA
FT                   MEVSTDLGNNTALLQGSVGITLPNAINKEYTKSPGIVIGNIWADPHYPVVGEPTMFTVS
FT                   GGVTGGVPPYHYTWTFDDGSIVQGTSAVHIFKQPGVHIVSLTVKDGVGNTATTTKKVYV
FT                   DPKLEVSVTVDTQNPAVGEKVFFSYKITGGFPFYINNHTYYKMYVDFGDGWGHLYGYYA
FT                   PTGTFNYTYTNPGEYLIYVRAWDNATNWYTWTYRITITYSNVNTNYGPLDANVTISPNP
FT                   GFTYKQETLKVWPINGTGIYNITVLWGDGNHSYWGYGYVYNPPLKFYHTYKVPGNYQIK
FT                   VYVNDSLGDSVEKVRQLRVFPGPLKAYLGNMTQNSTGAWVIFNTTSPKVVTPGEAAAGI
FT                   NLYANITGGTPGYTWQLINATTNYVVATGTTALPSDTPFYVWTFDDSSPGTYHFVFKVT
FT                   DHTNNIVYSNTYTIIVKSANLTIQLLPASVNVPIGGNVSFVIDIWNIQLNSSGAATINV
FT                   TFYNGTGSWPTWYHVYTFTNGTPGAIIYNTTPFEINESTTPALPVQVYGGNILPGDYTA
FT                   KATVNYGSAYNATNHETATSIVHVVSYPPISYVIWSEPYPAKITAGLPITIYVNISGGD
FT                   GLYSVNFNPNGTVSNVYTNDVNETISGPDSNGNWTVSNLVYYTAPDGKRYYNMSFVVVY
FT                   STPSPAQGYVLDGNVLSNAFTQYKGPFKVTIYVTPPSKLQVEFTGSSHYSYALPYRGNQ
FT                   TLGPHPLRTLLNDSYSFTLWLNISGGVPPYHVSMYFDGSVWGVVYLNGEFYGWVNSTTT
FT                   SVSYWTDVYPVGATKEAHYKFVLIYNDSYADGNMGIEAYVVSNYPSSFPYRESLYYTVW
FT                   AEPYLTIASIDQSAYSISVPGSVSFVVNAMWGDISHTHDYTYVWLMHDSSTHNYTIYAI
FT                   TSVPMITIEFENPDIYSVAVVVVSNVINETATAVYEDINATMPPTIVQVVSVRVEAELV
FT                   NPSGNSYIAYAGWADWDENGTIMASFVMPNVPNVNAVYTLEVTYSYTLAITNYDTYTHT
FT                   WQTYFYNAYSAHPYATAQLTVIAQGNVGPNLDTILAAINGVWHEVNVSRDNLMNAINNG
FT                   FTSVENGIVEIKTMGSTLNAKLSDLNANITDIQNGIATIKTDIGNIQTSLNNLDAKITD
FT                   IQNGIATIKTDIGNIQTSLNNLDAKITDIQNGIATIKTDIGNIQTSLNNLDAKITKLQG
FT                   DVATIQTDIGTVNVKLDAINATVVSNANGIKDLKGSIVTIQTTLGDIKGTVTDIKNGVA
FT                   TIQTDLGTMQTDVSNIKTSTSNTASGINTAIYWNIGVLILVIITLILVAYVLAKVNKIS
FT                   QAPKEETVEEETEEETKEE"
FT                   /protein_id="YP_003482514.1"
FT   misc_feature    complement(148418..>148573)
FT                   /note="polycystic kidney disease I (PKD) domain; similar to
FT                   other cell-surface modules, with an IG-like fold; domain
FT                   probably functions as a ligand binding site in
FT                   protein-protein or protein-carbohydrate interactions; a
FT                   single instance of the repeat is...; Region: PKD; cl14635"
FT                   /db_xref="CDD:176843"
FT                   /locus_tag="Aboo_0140"
FT   misc_feature    complement(<148172..>148570)
FT                   /note="polycystin cation channel protein; Region: PCC;
FT                   TIGR00864"
FT                   /db_xref="CDD:129943"
FT                   /locus_tag="Aboo_0140"
FT   misc_feature    complement(145202..145594)
FT                   /note="C terminus; Region: Baculo_PEP_C; pfam04513"
FT                   /db_xref="CDD:146915"
FT                   /locus_tag="Aboo_0140"
FT   misc_feature    complement(144977..>145576)
FT                   /note="fibritin; Provisional; Region: wac; PHA02607"
FT                   /db_xref="CDD:165002"
FT                   /locus_tag="Aboo_0140"
FT   gene            149210..149743
FT                   /db_xref="GeneID:8827078"
FT                   /locus_tag="Aboo_0141"
FT   CDS_pept        149210..149743
FT                   /locus_tag="Aboo_0141"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0318 hypothetical protein"
FT                   /db_xref="GI:289595819"
FT                   /db_xref="GeneID:8827078"
FT                   /translation="MELIIAIIGFLMSIVPLIVLPLKIRAGKIHYFLLYIFLVLFYLSY
FT                   IGYSIWHYDIFIMLIYIFEMLFFLNMYRAYLKKEFFFVAPFIAYSSDLAIIFSFYFITF
FT                   NLVEIGKNVLAKKGTSPIVLYSLISFELAVIAQLLTIISQHQYLNIIITSLFLAGTALF
FT                   IIPGLRVAYEKEKI"
FT                   /protein_id="YP_003482515.1"
FT   gene            149724..149999
FT                   /db_xref="GeneID:8827079"
FT                   /locus_tag="Aboo_0142"
FT   CDS_pept        149724..149999
FT                   /locus_tag="Aboo_0142"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PTO0319"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0319 hypothetical protein"
FT                   /db_xref="GI:289595820"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:8827079"
FT                   /translation="MKKKRSKSRVVFDVLSIIAQEDKCTVSIILRRANVSYSVFKEIEE
FT                   NLKKKNLIEVKTNGGKSIYKITKDGKEFLKEWRKFKRLMELYGLEP"
FT                   /protein_id="YP_003482516.1"
FT   misc_feature    149724..149978
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG3432"
FT                   /db_xref="CDD:33238"
FT                   /locus_tag="Aboo_0142"
FT   gene            complement(150016..151062)
FT                   /db_xref="GeneID:8827080"
FT                   /locus_tag="Aboo_0143"
FT   CDS_pept        complement(150016..151062)
FT                   /locus_tag="Aboo_0143"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04659"
FT                   /codon_start="1"
FT                   /product="flagella protein"
FT                   /transl_table="11"
FT                   /note="PFAM: flagella protein; Flagella accessory C family
FT                   protein; KEGG: pho:PH0553 hypothetical protein"
FT                   /db_xref="GI:289595821"
FT                   /db_xref="InterPro:IPR006752"
FT                   /db_xref="InterPro:IPR008039"
FT                   /db_xref="GeneID:8827080"
FT                   /translation="MAGLFKKKKKEKKPAKKAKKTKKVEEPEIPEIPAEAVPEISEAGI
FT                   NDAEIEKVLGTALKGLDIDELTTKLDDISRKIDEFQAKIERHDSMIGSLENEISEIRKV
FT                   NEEMQDNIKRLLDIYEVVSQKINPFIEMGERREMPITPDTVIPPEEPGIIPSVFEESTQ
FT                   IPEEKPREMPKEKQREYVQENPAPVEERRKEPELPKPGEGPILKHIKKDYYTIVLLMRW
FT                   IEFLFERVKRDKITLLLDYYVDIGWISKEVKSEIMAYARGEVQDVTKYFPEEEIEAEIE
FT                   TPAGTIRAPKPRIYKKVEDWRLSAEDHLKSLLFIMKIAGVEVNKDRLNSLEQEIEKFKK
FT                   SLWEYHGV"
FT                   /protein_id="YP_003482517.1"
FT   misc_feature    complement(150673..150837)
FT                   /note="Flagella accessory protein C (FlaC); Region:
FT                   FlaC_arch; cl10488"
FT                   /db_xref="CDD:127419"
FT                   /locus_tag="Aboo_0143"
FT   misc_feature    complement(150103..150447)
FT                   /note="Archaeal flagella protein; Region: Arch_fla_DE;
FT                   cl01322"
FT                   /db_xref="CDD:154334"
FT                   /locus_tag="Aboo_0143"
FT   gene            complement(151133..151783)
FT                   /db_xref="GeneID:8827081"
FT                   /locus_tag="Aboo_0144"
FT   CDS_pept        complement(151133..151783)
FT                   /locus_tag="Aboo_0144"
FT                   /gene_family="HOG000254458" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01917"
FT                   /codon_start="1"
FT                   /product="flagellin"
FT                   /transl_table="11"
FT                   /note="PFAM: flagellin; KEGG: mja:MJ0892 flagellin"
FT                   /db_xref="GI:289595822"
FT                   /db_xref="InterPro:IPR002774"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="GeneID:8827081"
FT                   /translation="MKKVWNKKEKGEMGIGTLIIFIAMIIVAAVAATVLIQTAYQLQQQ
FT                   AEETGNIAIQDVATGFKIIHVGGIVDNSTPSAPKVGIIQIKVGLIAGSPAIDMRNVLIE
FT                   LTDGTKDVTLNYTNVDITTTAGQVKLAATGEWLANTTFTAKILRDMPPQNWDNQRVVTQ
FT                   GDIVMLIINATAAGLNLTPQSQVTLQIIPKHGVPTYAAFMVPATLTTKYVDLY"
FT                   /protein_id="YP_003482518.1"
FT   sig_peptide     complement(151688..151783)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.969 at
FT                   residue 32"
FT                   /locus_tag="Aboo_0144"
FT   misc_feature    complement(151139..151756)
FT                   /note="Archaebacterial flagellin; Region: Arch_flagellin;
FT                   cl00732"
FT                   /db_xref="CDD:174366"
FT                   /locus_tag="Aboo_0144"
FT   gene            complement(151934..154819)
FT                   /db_xref="GeneID:8827082"
FT                   /locus_tag="Aboo_0145"
FT   CDS_pept        complement(151934..154819)
FT                   /locus_tag="Aboo_0145"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0786 oligosaccharyl transferase STT3
FT                   subunit"
FT                   /db_xref="GI:289595823"
FT                   /db_xref="GeneID:8827082"
FT                   /translation="MRSKHQFYKVRVATFALLAFLLFPVLFGGMSHSSSDLKEGNSEVL
FT                   MNNIIWRETSRLTWLGNSTKPQIMRSGDGNYNIVWQDDRNGEWDIYYLRVRPDGFKVVN
FT                   DTRITHFKGNDTNPVIGVMGDHIYIVWQRYVSGHWAIYFSRLLYSNKNILIEIPPIPVR
FT                   KINTDCINPKIAVDSNGDIDLVWQELNGSHWEIMYDKLDSYGTPLFSPILVSQSYMDSM
FT                   RPSIVVDNNNDVHIFWVGYSTTPGYSIFYRKLSPKGSFLTEIRRISVVSPKSTVESYYY
FT                   NNSLYTVFSCSRERLAYEVIFTRLSSSGYTEVDDTNLTVADKIDSMYPHLAVIHNRMFV
FT                   VWNDNPMGVIKFSIYDLNGNKIGKVLNISASNSFFPSISVNDRTIGIVWQKEVNGKFYL
FT                   YFRSAEFPDLKVESMSLYAQGSNITLKASLYSSVPLTTTYGIYLDGNLTLLRNVYINNV
FT                   VNVEEILNATPGWHRVKIFIDPFNHIIETNESNNAMEKMIYVKHYSFNISTNPVYYLPA
FT                   GRWSNISVYLSNTGNWVDNYTMRILYNTTLFKVQPDFKKVRLNESENEIVNFSVYIYRS
FT                   TIVGNYTMNLTVRSISSGIVEMRNITVRVLPYVNFNVEYAPMYTVLPGKKINIELIIEN
FT                   TGNCNDTYILNLHQSKNWPMMYESKLNVSYHSSKSIYITLLVPNGTYGFTKNYLNLTIK
FT                   SSRLNITKKASIMVIVKPVHKASVSILSLIENGTYYYTARIKVVNEGNMRDLFTIKLSG
FT                   NAAQFSYISNASLVLNPQGSYIVILHTYLPPYMPAGSYKVDFNVNYDNRSLASVPLLLT
FT                   VQESHQFIVNVKVLSQGKKVVLAAIIRNVGNTPELIMLIPKLAEKTNATWILYYNHKNF
FT                   TNVTSVYVKQNQTVNVTITLATNLTNGMHKATIIFRSASHITKNVTVEFRVGEKSIWEK
FT                   IGDFIMGNLTYVIIAAAVIVGVIVYFIKFRE"
FT                   /protein_id="YP_003482519.1"
FT   misc_feature    complement(152687..>153256)
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1470"
FT                   /db_xref="CDD:31659"
FT                   /locus_tag="Aboo_0145"
FT   misc_feature    complement(152009..>152848)
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1470"
FT                   /db_xref="CDD:31659"
FT                   /locus_tag="Aboo_0145"
FT   gene            complement(154794..155111)
FT                   /db_xref="GeneID:8827083"
FT                   /locus_tag="Aboo_0146"
FT   CDS_pept        complement(154794..155111)
FT                   /locus_tag="Aboo_0146"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Nmar_1306"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nmr:Nmar_1306 hypothetical protein"
FT                   /db_xref="GI:289595824"
FT                   /db_xref="GeneID:8827083"
FT                   /translation="MNLEAKSMVSVFMDRYSSQILLGTSMRAKGIRELSREYNIPVTVC
FT                   YRRIKKLVEMGLLMEEKVGKRLKYKSRINDFSAVLDFEGNKMKINMIADGENYEIEAPI
FT                   L"
FT                   /protein_id="YP_003482520.1"
FT   misc_feature    complement(154866..155072)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Aboo_0146"
FT   misc_feature    complement(order(154866..154871,154875..154880,
FT                   154944..154946,155034..155036,155043..155048,
FT                   155055..155060,155067..155069))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Aboo_0146"
FT   misc_feature    complement(order(154905..154913,154926..154934,
FT                   154950..154955,154959..154964,154971..154976,
FT                   154980..154991,155016..155024,155061..155069))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Aboo_0146"
FT   misc_feature    complement(order(154878..154880,155013..155015,
FT                   155022..155024))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Aboo_0146"
FT   gene            155328..155687
FT                   /db_xref="GeneID:8827084"
FT                   /locus_tag="Aboo_0147"
FT   CDS_pept        155328..155687
FT                   /locus_tag="Aboo_0147"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hsl:OE2375F hypothetical protein"
FT                   /db_xref="GI:289595825"
FT                   /db_xref="GeneID:8827084"
FT                   /translation="MVDKHALTLVLMDEYNLKILAASAIKPVSVREIAYRFDIPLASAY
FT                   RKIKELESMGLIKVDGTRLTPDGKRYKLYRSQVENFEVSYHKDKLKIKLHIKWQEPQII
FT                   ERDILSPTPQENLIH"
FT                   /protein_id="YP_003482521.1"
FT   misc_feature    155376..>155582
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Aboo_0147"
FT   gene            complement(155659..156612)
FT                   /db_xref="GeneID:8827085"
FT                   /locus_tag="Aboo_0148"
FT   CDS_pept        complement(155659..156612)
FT                   /locus_tag="Aboo_0148"
FT                   /gene_family="HOG000167994" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   mma:MM_1134 UDP-glucose 4-epimerase"
FT                   /db_xref="GI:289595826"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:8827085"
FT                   /translation="MKIMVTGGAGFIGSHIVDALMEEEHEVLVYDNLSSGKMEFIKEHM
FT                   GKENFKFVQADLLDFEKLKEEMEGVELVYHVAANPDVRLGASDTHVHLEQNVIATYNVL
FT                   EAMRLNDVKDIIFTSTSTVYGEANEIPTPEGYGPLIPISLYGASKLGAEAFITSYAHTF
FT                   GMSAVIYRFANIVGPRSTHGVIYDFIMKLKRNMHELEILGDGTQTKSYLYVKDCVDAII
FT                   FGYKNRKRDVEIFNIGSEDWINVRKIADIIVEEMGLQDVKYKFTGGKRGWKGDVPKMLL
FT                   SIEKIKSYGWKPKYNSEESVRLTARHLLNELNSLGV"
FT                   /protein_id="YP_003482522.1"
FT   misc_feature    complement(155680..156612)
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="Aboo_0148"
FT   misc_feature    complement(156070..156600)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Aboo_0148"
FT   gene            complement(156560..157273)
FT                   /db_xref="GeneID:8827086"
FT                   /locus_tag="Aboo_0149"
FT   CDS_pept        complement(156560..157273)
FT                   /locus_tag="Aboo_0149"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Memar_0521"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mem:Memar_0521 hypothetical protein"
FT                   /db_xref="GI:289595827"
FT                   /db_xref="GeneID:8827086"
FT                   /translation="MDRETMAVFVVRLYHFLYPIYAGTIFIITLYMVFPSLFLKVGTIL
FT                   LLYLIPPAGKESMVPALVVIFSPIYGFYGVLIAAALITVIDSIVAWWTVWNWDLLKYVP
FT                   LLNIYVRKIEEVGKKKWEKHTVIRKFAYAGLAAFVAIPFQGSGGFTAALIGRLLAMNEF
FT                   KILLSVVVGSFTGSFIIALLAYFSLWSFKEWGIFAVGGIVIFILVFVVVYLWLRGEKNE
FT                   NNGDGWSRIHRKSHR"
FT                   /protein_id="YP_003482523.1"
FT   misc_feature    complement(156758..157096)
FT                   /note="Putative small multi-drug export protein; Region:
FT                   Sm_multidrug_ex; cl01024"
FT                   /db_xref="CDD:154152"
FT                   /locus_tag="Aboo_0149"
FT   gene            complement(157280..157915)
FT                   /db_xref="GeneID:8827087"
FT                   /locus_tag="Aboo_0150"
FT   CDS_pept        complement(157280..157915)
FT                   /locus_tag="Aboo_0150"
FT                   /gene_family="HOG000106741" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01269"
FT                   /codon_start="1"
FT                   /product="fibrillarin"
FT                   /transl_table="11"
FT                   /note="PFAM: fibrillarin; KEGG: tac:Ta0949 fibrillarin"
FT                   /db_xref="GI:289595828"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="GeneID:8827087"
FT                   /translation="MRSSRYPGVYTDGKGFYTKSKFKESVYGERVLEIKGRFYRRWEPV
FT                   RSKLSAAMHLHLENFHFKGSKILYLGASTGTTVSHLSDIAELVWAVEISPMSMQKLVHL
FT                   GERRDNIVPILDDARYPEHYAIFVEKPNIIYQDVSQRDQVEIFLKNMEFYAPKFGYLML
FT                   KTRTIDVRKKPKEIMKEKARKIGELYSIEEIINISKYQKDHYAIVVRK"
FT                   /protein_id="YP_003482524.1"
FT   misc_feature    complement(157283..157915)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Aboo_0150"
FT   misc_feature    complement(157283..157906)
FT                   /note="Fibrillarin-like rRNA methylase [Translation,
FT                   ribosomal structure and biogenesis]; Region: NOP1; COG1889"
FT                   /db_xref="CDD:32073"
FT                   /locus_tag="Aboo_0150"
FT   gene            157991..159061
FT                   /db_xref="GeneID:8827088"
FT                   /locus_tag="Aboo_0151"
FT   CDS_pept        157991..159061
FT                   /locus_tag="Aboo_0151"
FT                   /gene_family="HOG000222354" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /codon_start="1"
FT                   /product="putative RNA methylase"
FT                   /transl_table="11"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: kcr:Kcr_0662 putative RNA methylase"
FT                   /db_xref="GI:289595829"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="GeneID:8827088"
FT                   /translation="MLFLSTTVHGLEDIAAREIEKFGARILELKTGKVIYEGNEELIYR
FT                   LNYGAKRIFRIAVILSMGKIKELEDTRKFVQEADFCINTTFAVRTKRRGEHDFTSMDVN
FT                   AVVGEEILKKCPKAKVNLDNPNLTFLCWVDNENFIFTIDTTGESLHRRGYRIYQHPAPI
FT                   NPVLASLMLKFAGWNGEKMVDPFCGSGTIPIEAYHNYNRVPNKFRTFNFPKLPFFDEAL
FT                   WNGIKEEMDKSERNKRLELYCVEKFKKHVNGCKLNAKNAGARFSCLQGDAENMHKFVDY
FT                   APFIITNPPFGLRIGSKKKIFKLYEEFAKELEEHFSGAILTLIIPYKKFENYFEVLEKR
FT                   DIMYGELQTKIYRFKI"
FT                   /protein_id="YP_003482525.1"
FT   misc_feature    157991..159058
FT                   /note="Predicted N6-adenine-specific DNA methylase [DNA
FT                   replication, recombination, and repair]; Region: COG0116"
FT                   /db_xref="CDD:30465"
FT                   /locus_tag="Aboo_0151"
FT   misc_feature    157991..>158368
FT                   /note="THUMP domain; Region: THUMP; cl12076"
FT                   /db_xref="CDD:159736"
FT                   /locus_tag="Aboo_0151"
FT   misc_feature    158444..159010
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Aboo_0151"
FT   gene            complement(159067..160398)
FT                   /db_xref="GeneID:8827089"
FT                   /locus_tag="Aboo_0152"
FT   CDS_pept        complement(159067..160398)
FT                   /locus_tag="Aboo_0152"
FT                   /gene_family="HOG000229729" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:TON_1432"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ton:TON_1432 hypothetical protein"
FT                   /db_xref="GI:289595830"
FT                   /db_xref="GeneID:8827089"
FT                   /translation="MEKRKVLILGAAGRDFHNFNVFFRNNPNYEVVAFTATQIPDIEGR
FT                   VYPPELAGDLYPDGIPILAEDDMEKIIKEKGVDIVVFAYSDVPHEHVMDLASRAHAAGA
FT                   DFWLLGPESTMLKSSKPVIAVTAVRTGSGKSQTSRKIFKLLREKGLKVVSIRHPMPYGD
FT                   LVKQRVQRFASYEDLDKNECTIEEREEYEPYIDMGGVVYAGVDYEAILREAEKEADVII
FT                   WDGGNNDFPFYKPDLWIVVADPHRPGHEMKYHPGETNFRAADVIIINKMDTANRDDIQE
FT                   IYNSIEKANPNAIVIEAASPLFVDKPELIKGKKVLVVEDGPTLTHGGMRYGAGYVAAKK
FT                   FGAKEIIDPRPYAVGSIVDTYKKYTHLHVILPAMGYGEKQMKELEETINNADADVVVSG
FT                   TPIDLNRVVKVNKPIVRVRYELDEIGKPDLEDILNDFLKKHNLS"
FT                   /protein_id="YP_003482526.1"
FT   misc_feature    complement(159082..160389)
FT                   /note="Predicted GTPase [General function prediction only];
FT                   Region: COG2403"
FT                   /db_xref="CDD:32539"
FT                   /locus_tag="Aboo_0152"
FT   misc_feature    complement(160084..>160257)
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:175423"
FT                   /locus_tag="Aboo_0152"
FT   misc_feature    complement(<159727..160008)
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:175213"
FT                   /locus_tag="Aboo_0152"
FT   misc_feature    complement(159508..>159777)
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:175213"
FT                   /locus_tag="Aboo_0152"
FT   gene            160486..164160
FT                   /db_xref="GeneID:8827090"
FT                   /locus_tag="Aboo_0153"
FT   CDS_pept        160486..164160
FT                   /locus_tag="Aboo_0153"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07705"
FT                   /codon_start="1"
FT                   /product="APHP domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rrs:RoseRS_1520 FHA domain-containing protein;
FT                   PFAM: APHP domain protein; peptidase C11 clostripain;
FT                   Thrombospondin type 3 repeat; Fibronectin type III domain
FT                   protein; SMART: Fibronectin type III domain protein"
FT                   /db_xref="GI:289595831"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005077"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="GeneID:8827090"
FT                   /translation="MGNGDLKMKFRMMLILFITAIFIIQILSGNITYGMAPKENANPIK
FT                   DIENELNGKIIIEKYKNLIYAVYTKQRMQNSYLLIYNGSWSKPVYVGGECPSLLVNAHG
FT                   IFITSSINHTPYIYYFSQGKWESKKLSNSYATITNLTYINSKLLIFWSGKTSLWLTIFG
FT                   KTSENVKIANANYPIREIHTHGFSVTIKMESESAWIYRTYSSFNLHQWYLLKEETKEKP
FT                   LKIYDYSYPTSNHYAKWTFMVYMDGDNSLSDATEGDLSEMERGYQNTSYVNVLVLWDKD
FT                   GNGDTKLIEIKNGGYEVLSAPWMKSELDMGNPDTLVDFVVWAMKTYPAQHYFLDLWDHG
FT                   GDYSGAMWDETSGSHLSLKDLHYAAEEIKKKTGGVDIWGYDACLMDAGADNYEIRNATK
FT                   IIVASEHTEGDDGWDYNAILYGLTSDPNMSAENFARYFVEHVDDENLHFSISTMAAINT
FT                   TALEFFMNSYNQFAQAVRAKAGSNNTEIKEAFQNAVSADTKYWHSGKDLGDLAKEILKY
FT                   VGDSNIRYWAKSMLDNATKSVIAYYDSDTNGRKMMMAETIEPAQTSTFSIFKDYQWDEM
FT                   LNQVYNIEKDDTNKAPSCQIESSKNITLQWGDEIAVYGSARDDNSIEYVEMKIDRGPWF
FT                   RIGGAQWSYQINTTHLSIGTHYIFVRAYDGDLYSQNEYITLHILPPPLPDLTISKDDIK
FT                   LNTSKPTEGDNITITLTVHNIGIKNAENVTASIYLDSTYPQQEIGTVNLGNISIGKSKN
FT                   ASIVWNTSGLMGKHRIIVYVDKNNKIKEIDENNNNASIPIFIYYPPSPPLTPTAKIGKN
FT                   SIFISWLAPMDDGGFPIKGYRIYRGTQKSNLSLTYEIKGNITEFSDYNITPDVRYYYAI
FT                   SAFTDAGESKLSEEISAFADNIKPWIRINSPYNNSIANKSHFMLTWKGNDSQSGLNHFE
FT                   IRWDNRSWINVGLERSYKIYLSNGKHHIFVKAVDNAGNFNISEIKVLVDTSPPTLKISY
FT                   PTKDVILNISNFEINFNVSDNLSGVSRCYFRIDKGLWKTINNDTLKISVNDGPHVIYLK
FT                   AVDRAGNIAYKERSFTVDTTPPEIYSISPPSNYTLNIKYSNLTIGWLARDNLGIAYFAI
FT                   KINNGSWIDLGMNETYTVKNPRQENYTILIKVVDLAGNYEIKKITIRCIIDSDGDGVPD
FT                   NEDAFPHNPKEWKDGDGDGIGDNEDFLPHFNNYIFYALITLLIISIAAIIKIKKFRRQ"
FT                   /protein_id="YP_003482527.1"
FT   misc_feature    161212..>161904
FT                   /note="Clostripain family; Region: Peptidase_C11; cl04055"
FT                   /db_xref="CDD:141798"
FT                   /locus_tag="Aboo_0153"
FT   misc_feature    162532..162804
FT                   /note="CARDB; Region: CARDB; pfam07705"
FT                   /db_xref="CDD:149004"
FT                   /locus_tag="Aboo_0153"
FT   misc_feature    162910..163149
FT                   /note="Fibronectin type 3 domain; One of three types of
FT                   internal repeats found in the plasma protein fibronectin.
FT                   Its tenth fibronectin type III repeat contains an RGD cell
FT                   recognition sequence in a flexible loop between 2 strands.
FT                   Approximately 2% of all...; Region: FN3; cd00063"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0153"
FT   misc_feature    order(163072..163074,163117..163119)
FT                   /note="Interdomain contacts; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0153"
FT   misc_feature    order(163120..163125,163129..163134)
FT                   /note="Cytokine receptor motif; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Aboo_0153"
FT   gene            complement(164147..167221)
FT                   /db_xref="GeneID:8827091"
FT                   /locus_tag="Aboo_0154"
FT   CDS_pept        complement(164147..167221)
FT                   /locus_tag="Aboo_0154"
FT                   /gene_family="HOG000246403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /codon_start="1"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /transl_table="11"
FT                   /note="KEGG: pto:PTO0411 isoleucyl-tRNA synthetase;
FT                   TIGRFAM: isoleucyl-tRNA synthetase"
FT                   /db_xref="GI:289595832"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015905"
FT                   /db_xref="GeneID:8827091"
FT                   /translation="MEIKNIADFPKVEEEILRKWEEGKIFEKLREKNRGNERFIFLEGP
FT                   PTANGMPHIGHALTRSVKDIILRYKAMDGYDIQPWIGGWDCHGLPVEIEVEKKLGINSK
FT                   REIEKFGIREFNKLCRESVFKYRDEWIKMTKRIGFWIDMENAYVTMEDYYIESVWWALK
FT                   KMYEEGLLVKDYKVVPYCPRCGTPLSSHEVAQGYKNVKDPSVYVKFKVKDENAYFLVWT
FT                   TTPWTLPSNLLLAVGEDIDYVLVEKDGERYYIAKARLKEVLGEAKILKELKGSQLKGKR
FT                   YERLIPYVPVNFDAFYVTTADFVSTEDGTGIVHIAPAFGEDDYNVCKREGIPLIKPVDE
FT                   EGKFTDTPWKGMFVKDADNHIIEWLKKEGKLYKKEKVEHSYPHCWRCGTPLLYYALDTW
FT                   YIRMSKKREELIKNNETVNWKPEHLKHGRFGNFLEEVKDWALSRNRYWGTPLPVWTCPD
FT                   GHVFIPEGKEDLLKHAEPDSIPEHFELHRPYVDELKIKCPVCGKEMKREPYLIDVWFDS
FT                   GSAPFAQFHYPYENKDEFERSFPVDFITEALDQTRGWFYTLMAISTVVFNRAPYKNVLT
FT                   LGLILDEDGEKMSKSKGNAVDPMEIMNNVGADAVRLYFYSTPVWKSRRFSENLVREYAQ
FT                   KTLMTLWNVYVFFKNNASLDNFTPDKIGEIKNELDSWLLSRLNTTIVEVRKNLDSLDIH
FT                   KATKAIEVFIDELSNWYLRRSRRRFWKEEVGEDKISAYTSLYLALKELAKLLAPFTPFF
FT                   AEYMYGNLWGKKESVHLEEYPRPRKELINKKLEEEMNVAIRIAEAGRRARQLANIKLRQ
FT                   PLASMTIVADEKFHPIIEKFVDVLREEVNVKEIKIESSAGSMVSIEIKPNYRVLGPKLK
FT                   GDMKKVLKELEKLPAEEIAKKIKNGVEIAGYILTEEDINIVEKPSQGILSVEVEGLPMV
FT                   VYLDTNITEELRLEGLAREIVRRIQAMRKDMDLQYAQKIKTFYEGDENLKRAIEKFRDY
FT                   IMRETQSIELEEGEKKGYQKEWSIDGMTIKLVIVS"
FT                   /protein_id="YP_003482528.1"
FT   misc_feature    complement(164156..167218)
FT                   /note="isoleucyl-tRNA synthetase; Reviewed; Region: ileS;
FT                   PRK06039"
FT                   /db_xref="CDD:168362"
FT                   /locus_tag="Aboo_0154"
FT   misc_feature    complement(<166682..167113)
FT                   /note="catalytic core domain of isoleucyl-tRNA synthetases;
FT                   Region: IleRS_core; cd00818"
FT                   /db_xref="CDD:173909"
FT                   /locus_tag="Aboo_0154"
FT   misc_feature    complement(167054..167065)
FT                   /note="HIGH motif; other site"
FT                   /db_xref="CDD:173909"
FT                   /locus_tag="Aboo_0154"
FT   misc_feature    complement(165347..>166054)
FT                   /note="catalytic core domain of isoleucyl-tRNA synthetases;
FT                   Region: IleRS_core; cd00818"
FT                   /db_xref="CDD:173909"
FT                   /locus_tag="Aboo_0154"
FT   misc_feature    complement(order(165452..165454,165458..165460,
FT                   165485..165487,165491..165493,165560..165562,
FT                   165572..165577,165584..165586,165680..165682))
FT                   /note="active site"
FT                   /db_xref="CDD:173909"
FT                   /locus_tag="Aboo_0154"
FT   misc_feature    complement(165449..165463)
FT                   /note="KMSKS motif; other site"
FT                   /db_xref="CDD:173909"
FT                   /locus_tag="Aboo_0154"
FT   misc_feature    complement(164849..165349)
FT                   /note="Anticodon-binding domain of archaeal, bacterial, and
FT                   eukaryotic cytoplasmic isoleucyl tRNA synthetases; Region:
FT                   Anticodon_Ia_Ile_ABEc; cd07961"
FT                   /db_xref="CDD:153415"
FT                   /locus_tag="Aboo_0154"
FT   misc_feature    complement(order(165074..165076,165083..165085,
FT                   165095..165097,165107..165109,165116..165121,
FT                   165128..165133,165140..165142,165281..165286,
FT                   165293..165295,165302..165304,165317..165319,
FT                   165326..165328,165338..165340))
FT                   /note="tRNA binding surface; other site"
FT                   /db_xref="CDD:153415"
FT                   /locus_tag="Aboo_0154"
FT   misc_feature    complement(order(165284..165286,165293..165295))
FT                   /note="anticodon binding site; other site"
FT                   /db_xref="CDD:153415"
FT                   /locus_tag="Aboo_0154"
FT   gene            complement(167244..167750)
FT                   /db_xref="GeneID:8827092"
FT                   /locus_tag="Aboo_0155"
FT   CDS_pept        complement(167244..167750)
FT                   /locus_tag="Aboo_0155"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein LOC100245835"
FT                   /db_xref="GI:289595833"
FT                   /db_xref="GeneID:8827092"
FT                   /translation="MNWRKVLGIILLIFGTSLFILDFIRMESIVLYILTFMAFISPILS
FT                   GKKVASYIHDSNLAKKKGFNASPTSFIYLWLFFWLFFLLVYTIGSIILSESIKFFISTL
FT                   SADYLGLLYTILLFVGSFYLFEGRYMSNDSFLTLWGRNVEKSRRVSKNAVEKVKEGTKY
FT                   FEKYL"
FT                   /protein_id="YP_003482529.1"
FT   gene            complement(167747..168415)
FT                   /db_xref="GeneID:8827093"
FT                   /locus_tag="Aboo_0156"
FT   CDS_pept        complement(167747..168415)
FT                   /locus_tag="Aboo_0156"
FT                   /gene_family="HOG000241645" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00126"
FT                   /codon_start="1"
FT                   /EC_number="4.1.2.4"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: deoxyribose-phosphate aldolase; KEGG:
FT                   tga:TGAM_0176 deoxyribose-phosphate aldolase
FT                   (phosphodeoxyriboaldolase) (deoxyriboaldolase) (DERA)
FT                   (DeoC); PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="GI:289595834"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="GeneID:8827093"
FT                   /translation="MDARELAKYIDHTNLKAFATREDIKRLCEEAKEYGFYAVCVNPYR
FT                   VKDAAEFLKGTDIKIASVVGFPLGATFTETKVQEAIMAVRNGADEIDMVMNIGAMKDGD
FT                   YGFVERDIREVVEAVHPMGAKVKVIIETCYLSDEEKIKACELAKKAGADFVKTSTGFGT
FT                   AGAKVEDVKLMRSVVGNDMGVKAAGGIHNAKQAIAMIEAGATRIGASRSVEIIETLELI
FT                   "
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /protein_id="YP_003482530.1"
FT   misc_feature    complement(167786..168400)
FT                   /note="2-deoxyribose-5-phosphate aldolase (DERA) of the
FT                   DeoC family. DERA belongs to the class I aldolases and
FT                   catalyzes a reversible aldol reaction between acetaldehyde
FT                   and glyceraldehyde 3-phosphate to generate 2-deoxyribose
FT                   5-phosphate. DERA is unique in...; Region: DeoC; cd00959"
FT                   /db_xref="CDD:29952"
FT                   /locus_tag="Aboo_0156"
FT   misc_feature    complement(order(168014..168016,168062..168067,
FT                   168122..168124,168128..168130,168155..168166,
FT                   168179..168181,168194..168196,168218..168220,
FT                   168281..168289,168359..168361,168365..168367,
FT                   168371..168373))
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29952"
FT                   /locus_tag="Aboo_0156"
FT   misc_feature    complement(order(167786..167794,167849..167857,
FT                   167939..167941,167948..167950))
FT                   /note="active site"
FT                   /db_xref="CDD:29952"
FT                   /locus_tag="Aboo_0156"
FT   misc_feature    complement(167948..167950)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29952"
FT                   /locus_tag="Aboo_0156"
FT   gene            168493..170172
FT                   /db_xref="GeneID:8827094"
FT                   /locus_tag="Aboo_0157"
FT   CDS_pept        168493..170172
FT                   /locus_tag="Aboo_0157"
FT                   /gene_family="HOG000256552" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /codon_start="1"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /transl_table="11"
FT                   /note="KEGG: mbu:Mbur_1703 DNA mismatch repair protein
FT                   MutL; TIGRFAM: DNA mismatch repair protein MutL; PFAM: MutL
FT                   dimerisation; DNA mismatch repair protein domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:289595835"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="GeneID:8827094"
FT                   /translation="MPEIRVLPPNIVEKIAAGEVVERPASVVKELVENSIDAGATKIAI
FT                   HVEGGGTKRIRVVDDGCGMSEEDAILALKRHATSKIKSEEDLNRISTLGFRGEALPSIA
FT                   AVSKLTIITKRKEDLVGTKIHVEGGEIKNITSIGAPSGTSVLVEDLFYNTPARRKFLKS
FT                   ERSEFFQIYSIVEKYAIIYENIHFKLVHNGKEVFNLPPSNLKARIARLWGKEIADAMVE
FT                   IKKSNRMKIKGLIAKPYQVRRDKNKLLIFVNGRYVKSRIIEDALVEGYGTLLFRDSYPI
FT                   AILKIQVEPDEIDVNVHPAKLFVKFKDENRIKKEIANLIWNSLTKEENIPSKIGGREER
FT                   AEKIKIEREKQMVFDVEEPSKMRKIEDFIPVMRTLPMEILGQVDGTYIILKSPEGLVIV
FT                   DQHAAHERIRYERFLKDMKDRNIQKLLEPIILNLDYKEYQFILEQKGSLRDYGFIIEDF
FT                   GTNSIVVRGIPPILTKRDAEDAIREIAQLGPKSIDEKRDELIKLISCKGAIKAHQKLSQ
FT                   FEMEKLIMDLLRCKNPYTCPHGRSTMIKIKNEDLEKMFKRKE"
FT                   /protein_id="YP_003482531.1"
FT   misc_feature    168502..169395
FT                   /note="DNA mismatch repair protein MutL; Region: mutl;
FT                   TIGR00585"
FT                   /db_xref="CDD:161941"
FT                   /locus_tag="Aboo_0157"
FT   misc_feature    168547..168873
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Aboo_0157"
FT   misc_feature    169102..169464
FT                   /note="MutL_Trans: transducer domain, having a ribosomal S5
FT                   domain 2-like fold, conserved in the C-terminal domain of
FT                   DNA mismatch repair (MutL/MLH1/PMS2) family. This
FT                   transducer domain is homologous to the second domain of the
FT                   DNA gyrase B subunit, which is...; Region: MutL_Trans;
FT                   cd00782"
FT                   /db_xref="CDD:48466"
FT                   /locus_tag="Aboo_0157"
FT   misc_feature    169393..169395
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48466"
FT                   /locus_tag="Aboo_0157"
FT   misc_feature    169630..170037
FT                   /note="MutL C terminal dimerization domain; Region: MutL_C;
FT                   cl07336"
FT                   /db_xref="CDD:157790"
FT                   /locus_tag="Aboo_0157"
FT   gene            complement(170173..171093)
FT                   /db_xref="GeneID:8827095"
FT                   /locus_tag="Aboo_0158"
FT   CDS_pept        complement(170173..171093)
FT                   /locus_tag="Aboo_0158"
FT                   /gene_family="HOG000022686" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /codon_start="1"
FT                   /EC_number="2.1.3.3"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; KEGG:
FT                   tvo:TVN0272 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain"
FT                   /db_xref="GI:289595836"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="GeneID:8827095"
FT                   /translation="MKKDLISIVDIKDELEEIIDLGLEMKRRQRMVEVYEPLKDKSMAM
FT                   IFEKPSTRTRVSFEVAMTQLGGHALYLSPRDMQLGRGETIADTARVLSRYVDAIVYRAY
FT                   KHENVVELAENASVPVINALDDLEHPCQIVADLMTIKEKKGGFRGLKLAYVGDGNNVAH
FT                   SLMLGAAIVGMNFYMACPDGYEPKKDIVGEARKIANETGAKIVITHDPVEAVKDADVIY
FT                   TDVWVSMGDEAEKEIRLKVFKPYQVNEELVRHAKSNYIFMHCLPAHRGYEVTDDVIDSR
FT                   NSVVFDEAENRLHAQKAILVRLIKP"
FT                   /product="ornithine carbamoyltransferase"
FT                   /protein_id="YP_003482532.1"
FT   misc_feature    complement(170179..171021)
FT                   /note="ornithine carbamoyltransferase; Provisional; Region:
FT                   PRK00779"
FT                   /db_xref="CDD:167059"
FT                   /locus_tag="Aboo_0158"
FT   misc_feature    complement(170665..>170988)
FT                   /note="Aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
FT                   /db_xref="CDD:145728"
FT                   /locus_tag="Aboo_0158"
FT   misc_feature    complement(170185..170649)
FT                   /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
FT                   binding domain; Region: OTCace; pfam00185"
FT                   /db_xref="CDD:143948"
FT                   /locus_tag="Aboo_0158"
FT   gene            complement(171162..171468)
FT                   /db_xref="GeneID:8827096"
FT                   /locus_tag="Aboo_R0005"