(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC1_1

ID   ACIC1_1; SV 1; empty ; DNA; empty ; PRO; 2443540 BP.
XX
AC   NC_008578;
XX
PR   Project: 58501;
XX
DE   Acidothermus cellulolyticus 11B, complete genome.
XX
OS   Acidothermus cellulolyticus 11B
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Frankineae;
OC   Acidothermaceae; Acidothermus.
XX
RN   [1]
RP   1-2443540
RX   PUBMED; 19270083.
RA   Barabote,R.D., Xie,G., Leu,D.H., Normand,P., Necsulea,A., Daubin,V.,
RA   Medigue,C., Adney,W.S., Xu,X.C., Lapidus,A., Parales,R.E., Detter,C.,
RA   Pujic,P., Bruce,D., Lavire,C., Challacombe,J.F., Brettin,T.S. and
RA   Berry,A.M.;
RT   "Complete genome of the cellulolytic thermophile Acidothermus
RT   cellulolyticus 11B provides insights into its ecophysiological and
RT   evolutionary adaptations";
RL   Genome Res. 19 (6), 1033-1043 (2009)
XX
RN   [2]
RP   1-2443540
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Zharchuk,I.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N.,
RA   Berry,A.M., Adney,W.S., Normand,P., Leu,D., Pujic,P. and Richardson,P.;
RT   "Complete sequence of Acidothermus cellulolyticus 11B";
RL   Unpublished
XX
RN   [3]
RP   1-2443540
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Zharchuk,I.,
RA   Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N.,
RA   Berry,A.M., Adney,W.S., Normand,P., Leu,D., Pujic,P. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (27-OCT-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
RN   [4]
RP   1-2443540
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-JAN-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000481.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000235
CC   Source DNA and bacteria available from Alison M. Berry
CC   (amberry@ucdavis.edu)
CC   Contacts: Alison M. Berry (amberry@ucdavis.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2443540
FT                   /note="type strain of Acidothermus cellulolyticus 11B"
FT                   /strain="11B; ATCC 43068"
FT                   /mol_type="genomic DNA"
FT                   /organism="Acidothermus cellulolyticus 11B"
FT                   /db_xref="ATCC:43068"
FT                   /db_xref="taxon:351607"
FT   gene            75..1517
FT                   /db_xref="GeneID:4484710"
FT                   /locus_tag="Acel_0001"
FT   CDS_pept        75..1517
FT                   /locus_tag="Acel_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: fra:Francci3_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="GI:117927212"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:4484710"
FT                   /translation="MAERVAGDPELAILWSRTVDRLQRQGDLSPQYQAWISLIQPLALV
FT                   EDTAVLAAPHSFAKEVLETRLRPALLAALAAEAGRELRIAVSVETPADVAAETASTSTA
FT                   TEADDVDEMDEAAHEPASGRSSIDLASQRRAHEAARLNPKYTFETFVIGASNRFAHAAA
FT                   FAAAESPAKAYNPLFIYGDSGLGKTHLLHAIGHYALSLFGNIRVRYVSSEEFTNDFINS
FT                   IRDGKAEGFRRRYRDVDVLLVDDIQFLENKEQTQEEFFHTFNTLHNANKQIVISSDRAP
FT                   KQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAAQEGLDIPNEVLEYIASKISS
FT                   NIRELEGALIRISAFANLNRQRVDLALAEVVLKDLIPDSQTPEITAALIMAETGAYFGV
FT                   SIEDLCGSSRSRVLVTARQVAMYLCRELTDLSLPKIGQHFGGRDHTTVMHADRKIRALM
FT                   AERRSIYNQVTELTNRIKMRAR"
FT                   /protein_id="YP_871763.1"
FT   misc_feature    105..1502
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Acel_0001"
FT   misc_feature    594..971
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acel_0001"
FT   misc_feature    615..638
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acel_0001"
FT   misc_feature    order(618..641,804..806,903..905)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acel_0001"
FT   misc_feature    792..809
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acel_0001"
FT   misc_feature    942..944
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Acel_0001"
FT   misc_feature    1236..1499
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Acel_0001"
FT   misc_feature    order(1299..1301,1323..1328,1347..1349,1365..1373,
FT                   1398..1412,1419..1421,1428..1433)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Acel_0001"
FT   gene            1921..3084
FT                   /db_xref="GeneID:4484711"
FT                   /locus_tag="Acel_0002"
FT   CDS_pept        1921..3084
FT                   /locus_tag="Acel_0002"
FT                   /gene_family="HOG000071793" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tfu:Tfu_0002 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="GI:117927213"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:4484711"
FT                   /translation="MRFQVDRGLFADAVAWSARTLPARPSMPVLGGLLIEAMDELRIAS
FT                   FDYEVSASASIDATIAETGRALVSGRLLAEISRNLPAQPVDVELDGSRLVIACGASRFT
FT                   LPLLPIEEYPNLPPLPTLAGTIGADLFATAVSQVVVAAGRDDTLPVLTGVRMEIDRDVM
FT                   TLAATDRYRLAVRDFHWQPARGDLTAAALIPARTLGEVAKALTTGAEVTIFLSTESTSN
FT                   ENLIGFSGRGTSGERQTTTRLIDGEYVKYRSLLPAEAAATAQVATAALIEAVRRVSLVA
FT                   PRTSPVRLTFNPDRLTLEAGTGDDAQASEWIDARFESSTGDDEFVIAFNPAYLLDGLGA
FT                   VESETTTLSFTSPNKPAVLRAGKDADTSADAGSDDYRYLLMPVRLGG"
FT                   /transl_table="11"
FT                   /protein_id="YP_871764.1"
FT   misc_feature    1921..3081
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK07761"
FT                   /db_xref="CDD:169087"
FT                   /locus_tag="Acel_0002"
FT   misc_feature    1921..3072
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acel_0002"
FT   misc_feature    order(1990..1992,2131..2133,2152..2154,2506..2508)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acel_0002"
FT   misc_feature    order(2134..2136,2143..2145,2218..2220,2224..2226,
FT                   2755..2757,2845..2850)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acel_0002"
FT   misc_feature    order(2422..2424,2428..2439,2908..2910,3061..3072)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acel_0002"
FT   misc_feature    order(2422..2424,2428..2433,2680..2682,2782..2784,
FT                   2821..2826,2917..2919,3061..3072)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Acel_0002"
FT   gene            3097..4212
FT                   /db_xref="GeneID:4484712"
FT                   /locus_tag="Acel_0003"