(data stored in ACNUC8465 zone)

HOGENOMDNA: ACIC5_1

ID   ACIC5_1; SV 1; empty ; DNA; empty ; PRO; 4127356 BP.
XX
AC   NC_012483;
XX
PR   Project: 59127;
XX
DE   Acidobacterium capsulatum ATCC 51196, complete genome.
XX
OS   Acidobacterium capsulatum ATCC 51196
OC   Bacteria; Acidobacteria; Acidobacteriales; Acidobacteriaceae;
OC   Acidobacterium.
XX
RN   [1]
RP   1-4127356
RX   PUBMED; 19201974.
RA   Ward,N.L., Challacombe,J.F., Janssen,P.H., Henrissat,B., Coutinho,P.M.,
RA   Wu,M., Xie,G., Haft,D.H., Sait,M., Badger,J., Barabote,R.D., Bradley,B.,
RA   Brettin,T.S., Brinkac,L.M., Bruce,D., Creasy,T., Daugherty,S.C.,
RA   Davidsen,T.M., DeBoy,R.T., Detter,J.C., Dodson,R.J., Durkin,A.S.,
RA   Ganapathy,A., Gwinn-Giglio,M., Han,C.S., Khouri,H., Kiss,H., Kothari,S.P.,
RA   Madupu,R., Nelson,K.E., Nelson,W.C., Paulsen,I., Penn,K., Ren,Q.,
RA   Rosovitz,M.J., Selengut,J.D., Shrivastava,S., Sullivan,S.A., Tapia,R.,
RA   Thompson,L.S., Watkins,K.L., Yang,Q., Yu,C., Zafar,N., Zhou,L. and
RA   Kuske,C.R.;
RT   "Three genomes from the phylum Acidobacteria provide insight into the
RT   lifestyles of these microorganisms in soils";
RL   Appl. Environ. Microbiol. 75 (7), 2046-2056 (2009)
XX
RN   [2]
RP   1-4127356
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-MAR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4127356
RA   Ward,N.L., Challacombe,J.F., Janssen,P.H., Henrissat,B., Coutinho,P.M.,
RA   Wu,M., Xie,G., Haft,D.H., Sait,M., Badger,J., Barabote,R.D., Bradley,B.,
RA   Brettin,T.S., Brinkac,L.M., Bruce,D., Creasy,T., Daugherty,S.C.,
RA   Davidsen,T.M., DeBoy,R.T., Detter,J.C., Dodson,R.J., Durkin,A.S.,
RA   Ganapathy,A., Gwinn-Giglio,M., Han,C.S., Khouri,H., Kiss,H., Kothari,S.P.,
RA   Madupu,R., Nelson,K.E., Nelson,W.C., Paulsen,I., Penn,K., Ren,Q.,
RA   Rosovitz,M.J., Selengut,J.D., Shrivastava,S., Sullivan,S.A., Tapia,R.,
RA   Thompson,L.S., Watkins,K.L., Yang,Q., Yu,C., Zafar,N., Zhou,L. and
RA   Kuske,C.R.;
RT   "Direct Submission";
RL   Submitted (26-FEB-2009) The J. Craig Venter Institute, Rockville, MD, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001472.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4127356
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:240015"
FT                   /note="type strain of Acidobacterium capsulatum"
FT                   /strain="ATCC 51196"
FT                   /organism="Acidobacterium capsulatum ATCC 51196"
FT                   /culture_collection="ATCC:51196"
FT   gene            complement(117..764)
FT                   /db_xref="GeneID:7699716"
FT                   /locus_tag="ACP_0001"
FT   CDS_pept        complement(117..764)
FT                   /locus_tag="ACP_0001"
FT                   /gene_family="HOG000257978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YkgG family protein"
FT                   /transl_table="11"
FT                   /note="YkgG family protein AMBIGUITY; this gene contains a
FT                   premature stop which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF02589"
FT                   /db_xref="GI:225871700"
FT                   /db_xref="GeneID:7699716"
FT                   /translation="MTQSEARAEILARIQSAVKGNDDRYEPEDSPANYRRAGTLTLPER
FT                   LDLFLERLREYDAQVMSVKAGDVASTIAGVLREADEAALPWVVADGFPAEWLARSPAVM
FT                   PESEAGVDELDRCAGVVTACSVGIAVTGTLVLRHGAGEGRRRTSLIPDRHLCVVRASQV
FT                   VETVPEAFARLADAATEPLTLISGPSATADIEMTRIRGVHGPRQLYVTLVLE"
FT                   /protein_id="YP_002753154.1"
FT   misc_feature    complement(126..428)
FT                   /note="Uncharacterized ACR, YkgG family COG1556; Region:
FT                   DUF162; cl00674"
FT                   /db_xref="CDD:153927"
FT                   /locus_tag="ACP_0001"
FT   gene            complement(751..2181)
FT                   /db_xref="GeneID:7699054"
FT                   /locus_tag="ACP_0002"
FT   CDS_pept        complement(751..2181)
FT                   /locus_tag="ACP_0002"
FT                   /gene_family="HOG000262102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02589; match to protein
FT                   family HMM TIGR00273"
FT                   /db_xref="GI:225871701"
FT                   /db_xref="GeneID:7699054"
FT                   /translation="MTIRVGDSAEAPSFQKAALPLLKDVQLRKNVRHATEVIQHKRDMV
FT                   AGELPDWQALREAAAAIKRKTLRHLDEYLEQFEAACLAAGGHVHWARDAEEANRIVLEL
FT                   VRQQNAQEVLKIKTMTADETGLNRALEQAGIHPHETDLAELIVQLGEDRPSHIVVPALH
FT                   KNRNQVREIFRDKMQRPDLGASPQDLTEAARQYLREKFLRVKTAIGGANFLIAETGGVC
FT                   IVESEGNGRMCLTLPETLILMVGVEKVIPRFQDLEVFLQLLPRSATGERMNPYNSIWTG
FT                   VHDGDGPKNFHVVLIDNGRTGILADEEARQTLQCIRCGACLNACPVYRQTGGHAYGSTY
FT                   GGPIGAILTPQLQNMEHAQSLPYASSLCGACYEVCPVKINIPEVLIHLRGRVVREQQSA
FT                   LKPETLGMKAVAAVFRSHRRLEAAQRLAQMAQAPLVKDGWIHRLPGELSAWTAARDLQA
FT                   IPKQSFRQWWKETHRDAE"
FT                   /protein_id="YP_002753155.1"
FT   misc_feature    complement(781..2145)
FT                   /note="Uncharacterized conserved protein containing a
FT                   ferredoxin-like domain [Energy production and conversion];
FT                   Region: COG1139"
FT                   /db_xref="CDD:31334"
FT                   /locus_tag="ACP_0002"
FT   misc_feature    complement(1294..1587)
FT                   /note="Uncharacterized ACR, YkgG family COG1556; Region:
FT                   DUF162; cl00674"
FT                   /db_xref="CDD:153927"
FT                   /locus_tag="ACP_0002"
FT   misc_feature    complement(772..1017)
FT                   /note="Domain of unknown function (DUF3390); Region:
FT                   DUF3390; pfam11870"
FT                   /db_xref="CDD:152306"
FT                   /locus_tag="ACP_0002"
FT   gene            complement(2178..2921)
FT                   /db_xref="GeneID:7701219"
FT                   /locus_tag="ACP_0003"
FT   CDS_pept        complement(2178..2921)
FT                   /locus_tag="ACP_0003"
FT                   /gene_family="HOG000262113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine-rich domain protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="GI:225871702"
FT                   /db_xref="GeneID:7701219"
FT                   /translation="MRVSLFITCYNDLLFPETGRSLVRLLERLGHTVEFPREQTCCGQM
FT                   HYNTGYQREAMPLMQRFVEIFQDAEAVCIPSSSCVAMIRDHYPKMAASTGDARLVGAVN
FT                   ALLPRVFEFSELLVHKLGVEDVGAYYPHRVTYHASCHSLRSLQLGDLPLRLLRKVRSID
FT                   LVELPNADRCCGFGGTFAVKNGDVSAEMLAEKMRDVENTGAEVCAAVDNSCLMHIYGGL
FT                   HQRKVGIRTVHLAEILASTEEETVR"
FT                   /protein_id="YP_002753156.1"
FT   misc_feature    complement(2190..>2921)
FT                   /note="Fe-S oxidoreductase [Energy production and
FT                   conversion]; Region: GlpC; COG0247"
FT                   /db_xref="CDD:30596"
FT                   /locus_tag="ACP_0003"
FT   misc_feature    complement(2670..2846)
FT                   /note="Cysteine-rich domain; Region: CCG; pfam02754"
FT                   /db_xref="CDD:111630"
FT                   /locus_tag="ACP_0003"
FT   misc_feature    complement(2268..2438)
FT                   /note="Cysteine-rich domain; Region: CCG; pfam02754"
FT                   /db_xref="CDD:111630"
FT                   /locus_tag="ACP_0003"
FT   gene            complement(3177..3653)
FT                   /db_xref="GeneID:7700831"
FT                   /locus_tag="ACP_0004"
FT   CDS_pept        complement(3177..3653)
FT                   /locus_tag="ACP_0004"
FT                   /gene_family="HOG000100513" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871703"
FT                   /db_xref="GeneID:7700831"
FT                   /translation="MYIQFQQYKLRSTKWEDIVSRIQPMHEKGLAMVAQDHLNPQNREL
FT                   RLEPDDIWQLLGGREGLKRMRKNADLLVNLAAYVQRWNFEEAVIIAERIRQDSMIVKRA
FT                   VFMIQLHMLLKKASPRVPFHMQQAAASYYLMTQRLLALYETCQYVRYPALAAAL"
FT                   /protein_id="YP_002753157.1"
FT   gene            complement(3710..4477)
FT                   /db_xref="GeneID:7698553"
FT                   /locus_tag="ACP_0005"
FT   CDS_pept        complement(3710..4477)
FT                   /locus_tag="ACP_0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871704"
FT                   /db_xref="GeneID:7698553"
FT                   /translation="MHLSLAARVLWAAGFTEQAALLLVLLLRKRFRAFPIFTIWIAFLV
FT                   LKNVVLFAVLGSLREYYYTYWLAEIIDLLLQIGVIYEICRNVLRPTGTWVRSALRSFLV
FT                   FGVAGIVLAAGLAWLAHPAESSFLGTWIERGRLFSSLITLELFVAMGFSSTRLGLVWRN
FT                   HVMAITTGWALWAAIGFAEELASAYHGPDYHGIVLDQIRIFSTQAVTVYWVAMFWLNEP
FT                   AERKLSPDMQIYLSNMQRRLESDAEILSNLRKP"
FT                   /protein_id="YP_002753158.1"
FT   gene            complement(4515..4694)
FT                   /db_xref="GeneID:7697933"
FT                   /locus_tag="ACP_0006"
FT   CDS_pept        complement(4515..4694)
FT                   /locus_tag="ACP_0006"
FT                   /gene_family="HOG000100622" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871705"
FT                   /db_xref="GeneID:7697933"
FT                   /translation="MKKIARTAVLALVAMGAVAIATPAHAGIFGSEPMPPVNLPPHSSI
FT                   VGVVINAVIGSLGI"
FT                   /protein_id="YP_002753159.1"
FT   gene            complement(4764..4943)
FT                   /db_xref="GeneID:7699762"
FT                   /locus_tag="ACP_0007"
FT   CDS_pept        complement(4764..4943)
FT                   /locus_tag="ACP_0007"
FT                   /gene_family="HOG000100622" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871706"
FT                   /db_xref="GeneID:7699762"
FT                   /translation="MKKIARTAVLALVAMGAVAIATPAHAGIFGSEPMPPVNLPPHSTV
FT                   VSVIVTAFFSTVGL"
FT                   /protein_id="YP_002753160.1"
FT   gene            complement(5009..5188)
FT                   /db_xref="GeneID:7698116"
FT                   /locus_tag="ACP_0008"
FT   CDS_pept        complement(5009..5188)
FT                   /locus_tag="ACP_0008"
FT                   /gene_family="HOG000100622" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:225871707"
FT                   /db_xref="GeneID:7698116"
FT                   /translation="MKKIARTAVLALVAMGAVAIATPAHAGIFGSEPMPPVNLPPHSTV
FT                   VSVVINAVIGTLGL"
FT                   /protein_id="YP_002753161.1"
FT   gene            complement(5695..7197)
FT                   /db_xref="GeneID:7701013"
FT                   /locus_tag="ACP_0009"
FT   CDS_pept        complement(5695..7197)
FT                   /locus_tag="ACP_0009"
FT                   /gene_family="HOG000260707" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tat pathway signal sequence domain protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF06824;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="GI:225871708"
FT                   /db_xref="GeneID:7701013"
FT                   /translation="MVKRTTHPRITEMKNDSSSLAPTPITRRDLLRGGMAASALAAFPL
FT                   AQYKAATWKMDQGRPPVGERKFQSPAIEAAIQRVKALIADPVLGRMFERCFPNTLDTTV
FT                   FPGSVNGKPDTFVITGDIDAMWLRDSSAQVHPYLPFARQDAGLARLLEGVVRRQTRMIL
FT                   IDPYANAFMRSTTDPPLSWSLHDRTTMKPGVAERKWEIDSLCYTVRLAHGYWQATGDTS
FT                   PFDAEWRQAAQSILTTFKQQQRLQGQGPYSFGRLTTNPYDTLALNGYGNVARPVGMIYS
FT                   MFRPSDDSCVYPLFVPANLFAVRALEQLQELAAKAAGAPGIAEQCESLLETVRAALRQY
FT                   GTVQHPEHGRIWAYEVDGYGNTLCMDDANVPSLLSLPYLGCCDSNDPLYQNTRRFVLST
FT                   ANPWYFEGSAAQGIGSPHTGRNAIWPMSLLIRALTSTHDEEIVACLRWLRNTTGGTGYM
FT                   HESFDASDPSQYTRPWFAWANTLFGELVLKLAHEKPSLLQQA"
FT                   /protein_id="YP_002753162.1"
FT   misc_feature    complement(5707..7005)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG3538"
FT                   /db_xref="CDD:33340"
FT                   /locus_tag="ACP_0009"
FT   misc_feature    complement(5737..6945)
FT                   /note="Protein of unknown function (DUF1237); Region:
FT                   DUF1237; pfam06824"
FT                   /db_xref="CDD:148436"
FT                   /locus_tag="ACP_0009"
FT   gene            7314..9761
FT                   /db_xref="GeneID:7698253"
FT                   /locus_tag="ACP_0010"
FT   CDS_pept        7314..9761
FT                   /locus_tag="ACP_0010"
FT                   /gene_family="HOG000122165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF07971;
FT                   match to protein family HMM TIGR01180; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="GI:225871709"
FT                   /db_xref="GeneID:7698253"
FT                   /translation="MKQRAIQRRDFLKACAAAAAASAIPAYGLRWNSAHALLMPATKAA
FT                   GEMQDVLPMIGTGWHGHMFPGAVMPFGMVQLSPDTSGMPEPKWNGKWDITGWDHCSGYH
FT                   YTDNVVQGFSHTHLQGTGASDLGDVLLMPMVKGRNWSWNSGTPAQQAEAQIEALGENSG
FT                   WVMNAGERGYWSFFSHDEEEARPGYYRVHLKTPDVRAELTATTRCGMHRYHYPATGVHG
FT                   LMLDLVHGIGCEVYAAELHVESTTRVRGVRSTHGWAADKQVYFVAEFSRPFASVEVRVD
FT                   GKEQSLQAGDHVAGKQVQAIFTQADSADALVVRVGISATSMEGAAKNLAAEIPHFDFDR
FT                   QRGEAGKAWNDALQVLQADCPTPAMQQTFDTAMYHGLVAPATFNDVDGAYRGQDHKNYP
FT                   NPGFTKYTTLSIWDIYRGEFPFIMLMQPHRVRDIIETLLADYRQLNQNSLPVWPLWGNE
FT                   TWCMTGFHVVGMIVGAYARGFRDFDVDAAYAAMRDTALVGAKANGNFELQQQFRKLGYV
FT                   ASGGRNQSVSRTLDFSYDYWCVGAMAELLGKKDDAAMFYKLGQNYRNIFDPASGFMRGK
FT                   TEEGAWHEPFRPDEEYWQDYTESDAWQATFNVMQDVQGLIGLYGGNDAFIAKLDALFAA
FT                   PSNILNSPPDISGMVGQDAQGNEPSNHIPYLYSFAGAPWKTQERVRQVAALYNNTPAGV
FT                   PGNDDCGQISSWFAFAAMGFYPVNAVTGVYVIGSPMVERAVLRNPKSGTTFTVVTENNS
FT                   ERNLYIQSAEWNGKPLTRCWITHEQILAGGELRFRMGSQPNKRWGSAPEDRPPSGLVHT
FT                   KQM"
FT                   /protein_id="YP_002753163.1"
FT   misc_feature    7464..9698
FT                   /note="alpha-1,2-mannosidase, putative; Region: aman2_put;
FT                   TIGR01180"
FT                   /db_xref="CDD:162240"
FT                   /locus_tag="ACP_0010"
FT   misc_feature    8196..9692
FT                   /note="Glycosyl hydrolase family 92; Region:
FT                   Glyco_hydro_92; pfam07971"
FT                   /db_xref="CDD:149187"
FT                   /locus_tag="ACP_0010"
FT   gene            complement(9860..11992)
FT                   /db_xref="GeneID:7698002"
FT                   /locus_tag="ACP_0011"
FT   CDS_pept        complement(9860..11992)
FT                   /locus_tag="ACP_0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fusaric acid resistance domain protein"
FT                   /transl_table="11"
FT                   /note="identified by similarity to SP:P32715"
FT                   /db_xref="GI:225871710"
FT                   /db_xref="GeneID:7698002"
FT                   /translation="MTTATAGRTDTRGFAAWFADFLRSELAPYPGRGMLVARMVISATI
FT                   TMILIMTFRIPGAATGPLYAFLISRENLVSSARSAFYLIIAFGLCAVFVPLGGHMFGSI
FT                   PLTHFLWEGISIFLIFFLIRTLENYTITSGIALIGSSALAIWYLPGPANANVENTLWAV
FT                   LAPTIGAAVTIAVEVVFHTFHKQDELVDGLNRRLKTIEDVLRCYAECKDRPRELERRLT
FT                   QNAMVGVSSLRRSVMRSNYTRLYRAQMNAIVSLTGRSLDFAAAMTHTDPVLSLPDQQVA
FT                   LKLAEHLAAIQNCLASKCVPPALARVSTGQTMPMLRELEEMFSLIPRVLEGSAELEAFE
FT                   AFTENIDQGFHIFIRDAFQNPDHLRYALSGCLAGMLCYITYMALDWPGLATSVTTCALT
FT                   ALSNVGASRQKQLLLVAGAVIGGFIFGMGAQIVVLPWLNGITGFALFFAAVTAFAAWVG
FT                   TSSTRLSYCGLQIALAFYLINVNDFRIQLSLSIARNRALGVLLGIFMMWLVFERLHPKS
FT                   AVNQMVETFTRNLSLLGQLSEFTLPGHDAKAITRVRRLRARIFDNFGAVNAQADAVPFE
FT                   IGPRRNQHMAARDRIRRWQAMLRGFYILELALLQYTAFAVAETLTDETLRDLEAFDRLC
FT                   SQRLAIMAESLQKQTDDSPDAPLLPQPDCPEWPQWLQHGNQEEMQRGILSLATELARIL
FT                   DRLWSDISSASLYAVE"
FT                   /protein_id="YP_002753164.1"
FT   misc_feature    complement(<10385..11932)
FT                   /note="Bacterial protein of unknown function (DUF939);
FT                   Region: DUF939; cl12136"
FT                   /db_xref="CDD:175407"
FT                   /locus_tag="ACP_0011"
FT   gene            complement(11995..13236)
FT                   /db_xref="GeneID:7700347"
FT                   /locus_tag="ACP_0012"