(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE10

ACIC5_1.PE10         Location/Qualifiers
FT   CDS_pept        7314..9761
FT                   /locus_tag="ACP_0010"
FT                   /gene_family="HOG000122165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF07971;
FT                   match to protein family HMM TIGR01180; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="GI:225871709"
FT                   /db_xref="GeneID:7698253"
FT                   /translation="MKQRAIQRRDFLKACAAAAAASAIPAYGLRWNSAHALLMPATKAA
FT                   GEMQDVLPMIGTGWHGHMFPGAVMPFGMVQLSPDTSGMPEPKWNGKWDITGWDHCSGYH
FT                   YTDNVVQGFSHTHLQGTGASDLGDVLLMPMVKGRNWSWNSGTPAQQAEAQIEALGENSG
FT                   WVMNAGERGYWSFFSHDEEEARPGYYRVHLKTPDVRAELTATTRCGMHRYHYPATGVHG
FT                   LMLDLVHGIGCEVYAAELHVESTTRVRGVRSTHGWAADKQVYFVAEFSRPFASVEVRVD
FT                   GKEQSLQAGDHVAGKQVQAIFTQADSADALVVRVGISATSMEGAAKNLAAEIPHFDFDR
FT                   QRGEAGKAWNDALQVLQADCPTPAMQQTFDTAMYHGLVAPATFNDVDGAYRGQDHKNYP
FT                   NPGFTKYTTLSIWDIYRGEFPFIMLMQPHRVRDIIETLLADYRQLNQNSLPVWPLWGNE
FT                   TWCMTGFHVVGMIVGAYARGFRDFDVDAAYAAMRDTALVGAKANGNFELQQQFRKLGYV
FT                   ASGGRNQSVSRTLDFSYDYWCVGAMAELLGKKDDAAMFYKLGQNYRNIFDPASGFMRGK
FT                   TEEGAWHEPFRPDEEYWQDYTESDAWQATFNVMQDVQGLIGLYGGNDAFIAKLDALFAA
FT                   PSNILNSPPDISGMVGQDAQGNEPSNHIPYLYSFAGAPWKTQERVRQVAALYNNTPAGV
FT                   PGNDDCGQISSWFAFAAMGFYPVNAVTGVYVIGSPMVERAVLRNPKSGTTFTVVTENNS
FT                   ERNLYIQSAEWNGKPLTRCWITHEQILAGGELRFRMGSQPNKRWGSAPEDRPPSGLVHT
FT                   KQM"
FT                   /protein_id="YP_002753163.1"
     GTGAAGCAGC GCGCGATACA GCGGCGAGAT TTTTTGAAAG CATGTGCAGC GGCTGCGGCC        60
     GCTTCGGCAA TTCCGGCCTA TGGATTGCGG TGGAATTCTG CGCATGCGCT ATTGATGCCG       120
     GCCACCAAAG CCGCAGGCGA GATGCAGGAT GTGCTGCCGA TGATCGGCAC CGGATGGCAC       180
     GGGCATATGT TCCCAGGTGC GGTGATGCCC TTCGGCATGG TGCAGCTCAG CCCTGACACC       240
     AGCGGAATGC CCGAGCCGAA GTGGAACGGG AAATGGGACA TCACAGGCTG GGATCATTGC       300
     TCCGGATATC ACTACACCGA CAACGTCGTG CAGGGCTTCA GCCATACGCA CCTGCAGGGC       360
     ACCGGCGCCA GCGATCTGGG AGATGTGCTC CTCATGCCGA TGGTCAAAGG CCGCAACTGG       420
     AGCTGGAACT CCGGCACTCC GGCGCAGCAG GCGGAGGCGC AGATCGAGGC TCTGGGTGAA       480
     AACTCAGGCT GGGTCATGAA TGCGGGCGAG CGGGGCTACT GGTCCTTCTT CTCCCATGAC       540
     GAGGAAGAAG CCCGCCCAGG CTATTACCGG GTGCATTTGA AGACTCCCGA TGTGCGAGCA       600
     GAGTTGACCG CAACCACTCG CTGCGGTATG CATCGCTATC ACTATCCTGC AACCGGTGTG       660
     CACGGCCTCA TGCTCGATCT GGTGCACGGC ATCGGCTGCG AGGTTTATGC GGCGGAATTG       720
     CATGTGGAGA GCACGACCCG CGTCCGTGGC GTACGCTCCA CGCATGGATG GGCCGCCGAC       780
     AAGCAGGTCT ATTTTGTAGC CGAGTTTTCG CGGCCCTTTG CCTCGGTGGA AGTCCGGGTG       840
     GACGGCAAAG AGCAGTCACT CCAGGCGGGC GATCATGTCG CCGGAAAGCA GGTTCAGGCC       900
     ATCTTTACGC AGGCTGACAG CGCAGATGCG CTGGTGGTTC GCGTTGGCAT CTCGGCCACG       960
     AGCATGGAAG GCGCCGCGAA GAATCTTGCG GCAGAGATTC CGCATTTTGA CTTTGACCGC      1020
     CAGCGCGGAG AAGCCGGGAA AGCCTGGAAC GATGCGCTGC AGGTGTTGCA GGCCGATTGC      1080
     CCCACGCCCG CGATGCAGCA GACCTTTGAC ACCGCGATGT ATCACGGCCT CGTCGCACCA      1140
     GCGACCTTCA ATGATGTGGA TGGCGCGTAT CGCGGACAGG ACCACAAGAA CTATCCCAAC      1200
     CCTGGATTCA CGAAGTACAC CACACTTTCG ATCTGGGATA TCTATCGCGG CGAATTCCCC      1260
     TTCATCATGC TCATGCAGCC TCACCGCGTG CGTGACATCA TTGAGACGCT GCTCGCCGAC      1320
     TATCGCCAGC TCAATCAGAA TTCCTTGCCC GTGTGGCCCC TGTGGGGCAA TGAGACTTGG      1380
     TGCATGACAG GCTTCCATGT GGTGGGCATG ATTGTGGGTG CGTATGCGCG AGGCTTTCGT      1440
     GACTTCGACG TGGACGCAGC GTACGCCGCG ATGCGAGACA CGGCGCTCGT CGGGGCCAAA      1500
     GCGAATGGCA ACTTTGAGCT GCAGCAGCAA TTCCGCAAGC TGGGTTACGT TGCCTCTGGC      1560
     GGACGCAACC AGTCCGTGTC GCGCACCCTC GATTTTTCCT ATGACTATTG GTGCGTCGGG      1620
     GCGATGGCCG AACTGCTCGG CAAAAAAGAC GACGCCGCAA TGTTTTACAA ACTGGGGCAG      1680
     AATTACCGGA ACATCTTTGA TCCGGCCAGC GGTTTCATGC GGGGCAAAAC CGAAGAGGGC      1740
     GCATGGCATG AGCCCTTCCG GCCTGATGAA GAGTACTGGC AGGACTACAC CGAGTCCGAT      1800
     GCCTGGCAGG CGACCTTCAA CGTCATGCAG GATGTGCAGG GACTCATCGG TCTCTATGGC      1860
     GGAAACGACG CGTTCATCGC CAAGCTGGAT GCGCTCTTCG CCGCGCCATC GAACATTCTC      1920
     AATTCGCCAC CGGACATCAG CGGCATGGTC GGCCAGGATG CCCAGGGCAA TGAGCCCAGC      1980
     AATCACATCC CGTACCTCTA CTCGTTTGCC GGGGCTCCCT GGAAGACGCA GGAGCGCGTG      2040
     CGGCAGGTGG CCGCGCTTTA CAACAACACA CCGGCGGGTG TGCCCGGCAA TGATGATTGC      2100
     GGCCAGATCT CCAGTTGGTT TGCCTTTGCG GCGATGGGCT TTTATCCAGT GAATGCGGTC      2160
     ACCGGTGTTT ACGTCATCGG CAGTCCGATG GTGGAGCGCG CTGTGTTGCG CAATCCTAAG      2220
     AGTGGAACGA CCTTCACTGT CGTGACTGAG AACAACTCGG AACGGAACCT CTACATCCAG      2280
     AGCGCCGAGT GGAATGGAAA GCCTCTCACC CGTTGCTGGA TCACGCATGA GCAGATTCTT      2340
     GCCGGTGGGG AACTGCGCTT CCGTATGGGC AGCCAGCCCA ACAAGCGTTG GGGCTCCGCG      2400
     CCCGAGGATC GTCCTCCGTC GGGGCTTGTG CATACAAAGC AGATGTAA                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page