(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE11

ACIC5_1.PE11         Location/Qualifiers
FT   CDS_pept        complement(9860..11992)
FT                   /locus_tag="ACP_0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fusaric acid resistance domain protein"
FT                   /transl_table="11"
FT                   /note="identified by similarity to SP:P32715"
FT                   /db_xref="GI:225871710"
FT                   /db_xref="GeneID:7698002"
FT                   /translation="MTTATAGRTDTRGFAAWFADFLRSELAPYPGRGMLVARMVISATI
FT                   TMILIMTFRIPGAATGPLYAFLISRENLVSSARSAFYLIIAFGLCAVFVPLGGHMFGSI
FT                   PLTHFLWEGISIFLIFFLIRTLENYTITSGIALIGSSALAIWYLPGPANANVENTLWAV
FT                   LAPTIGAAVTIAVEVVFHTFHKQDELVDGLNRRLKTIEDVLRCYAECKDRPRELERRLT
FT                   QNAMVGVSSLRRSVMRSNYTRLYRAQMNAIVSLTGRSLDFAAAMTHTDPVLSLPDQQVA
FT                   LKLAEHLAAIQNCLASKCVPPALARVSTGQTMPMLRELEEMFSLIPRVLEGSAELEAFE
FT                   AFTENIDQGFHIFIRDAFQNPDHLRYALSGCLAGMLCYITYMALDWPGLATSVTTCALT
FT                   ALSNVGASRQKQLLLVAGAVIGGFIFGMGAQIVVLPWLNGITGFALFFAAVTAFAAWVG
FT                   TSSTRLSYCGLQIALAFYLINVNDFRIQLSLSIARNRALGVLLGIFMMWLVFERLHPKS
FT                   AVNQMVETFTRNLSLLGQLSEFTLPGHDAKAITRVRRLRARIFDNFGAVNAQADAVPFE
FT                   IGPRRNQHMAARDRIRRWQAMLRGFYILELALLQYTAFAVAETLTDETLRDLEAFDRLC
FT                   SQRLAIMAESLQKQTDDSPDAPLLPQPDCPEWPQWLQHGNQEEMQRGILSLATELARIL
FT                   DRLWSDISSASLYAVE"
FT                   /protein_id="YP_002753164.1"
     atgaccactg cgaccgcggg acggaccgat acacgcggat ttgccgcatg gtttgctgat        60
     tttctgcgca gcgaactggc cccttatccg ggccgcggca tgctggttgc gcgcatggtg       120
     atctcggcga cgatcaccat gatcctgatc atgacgtttc gtatcccggg cgccgcgacc       180
     ggcccgctgt atgcatttct gatctcccgg gaaaacctgg tttcctccgc cagatccgcc       240
     ttttacctga tcattgcttt cggcttgtgc gcagtgttcg tacctttggg cggacatatg       300
     ttcggctcga ttccgcttac ccatttctta tgggaaggca tcagcatctt tctgatcttc       360
     tttctgatca gaacgctcga aaactacacg attacgagcg gtattgcgct gatcggcagc       420
     tcggcgctgg ccatctggta tctgccgggt ccggccaatg ccaatgtaga aaacactctc       480
     tgggcagtgc tcgcgccgac cattggcgcg gcggtcacga ttgcggttga ggtggtcttt       540
     cacacctttc ataagcagga tgagttggtg gatggcctga atcgcagatt gaagaccatc       600
     gaagatgttc tgcgctgcta tgcggaatgc aaagatcgcc cgcgcgaact ggagcgccgc       660
     ctgacacaga acgcaatggt gggcgtgagt agtctgcgca gatctgtcat gcggtcaaac       720
     tacacgcgcc tttatcgcgc gcagatgaat gccattgtct ccctgacggg acgctcgctc       780
     gattttgcgg cggcgatgac gcataccgat ccggtgcttt cgcttcccga tcaacaggtt       840
     gcgctcaagc tggccgagca tcttgccgca attcaaaact gcctggcgtc caaatgtgtt       900
     cctcccgcgc tggcgcgcgt ctctacgggg caaaccatgc cgatgttgcg cgaactggaa       960
     gaaatgtttt cgctcatccc gcgagttctc gaaggatcgg ccgagttgga ggcgtttgaa      1020
     gcgttcactg aaaacatcga ccagggtttt catattttca ttcgcgacgc ttttcagaat      1080
     cccgaccacc tgcgctatgc cttgagcgga tgcctcgccg gcatgctctg ctacatcact      1140
     tatatggcgc tggactggcc gggcctggcc acctcagtga ccacctgcgc cctgacggcg      1200
     ctctcgaatg taggcgcatc gcggcaaaag caattgctgc tggtggcagg cgcggtgatc      1260
     ggcggattca tctttggcat gggggcccag attgtggtgc tgccgtggct gaatggcatc      1320
     acgggattcg cgctgttctt tgccgccgtg actgcgtttg ccgcctgggt aggaacctca      1380
     agcacccggc tctcatactg cggactgcag attgcgcttg cgttttacct gatcaatgtg      1440
     aatgatttcc gcattcagct ttcactgtcg atcgcacgaa atcgcgcgct gggtgtgctg      1500
     cttggaattt tcatgatgtg gctcgtcttc gagcgactcc atccaaaatc cgcagtcaac      1560
     cagatggtgg agactttcac tcgaaacctg agcctgctcg gccagttgag cgagttcaca      1620
     cttcctggcc acgacgcaaa ggcgatcacc cgcgtgaggc gcttgcgcgc ccgcatcttc      1680
     gataactttg gcgcggtgaa tgcgcaggcc gatgccgttc cctttgagat tggcccgcgc      1740
     cgcaatcagc acatggctgc ccgagaccgc attcggcgct ggcaggccat gctgcgcgga      1800
     ttctatattt tagaactggc actgttgcaa tatacggcgt tcgccgtggc cgagacgttg      1860
     acagacgaaa ctctgcgcga cctggaagca tttgaccgtc tttgctcgca gcggctcgcc      1920
     atcatggcag aatcattgca aaagcagacc gatgattcgc cggacgcacc actgctgcca      1980
     cagcccgact gccccgagtg gccgcagtgg ctgcagcatg gcaatcagga agagatgcag      2040
     cgcggcattc tctcgctggc caccgaactg gcgcgcattc tcgaccggtt atggagcgat      2100
     atatcttccg cttcgctcta cgccgttgag tag                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page