(data stored in ACNUC7421 zone)

HOGENOMDNA: ACIC5_1.PE2

ACIC5_1.PE2          Location/Qualifiers
FT   CDS_pept        complement(751..2181)
FT                   /locus_tag="ACP_0002"
FT                   /gene_family="HOG000262102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02589; match to protein
FT                   family HMM TIGR00273"
FT                   /db_xref="GI:225871701"
FT                   /db_xref="GeneID:7699054"
FT                   /translation="MTIRVGDSAEAPSFQKAALPLLKDVQLRKNVRHATEVIQHKRDMV
FT                   AGELPDWQALREAAAAIKRKTLRHLDEYLEQFEAACLAAGGHVHWARDAEEANRIVLEL
FT                   VRQQNAQEVLKIKTMTADETGLNRALEQAGIHPHETDLAELIVQLGEDRPSHIVVPALH
FT                   KNRNQVREIFRDKMQRPDLGASPQDLTEAARQYLREKFLRVKTAIGGANFLIAETGGVC
FT                   IVESEGNGRMCLTLPETLILMVGVEKVIPRFQDLEVFLQLLPRSATGERMNPYNSIWTG
FT                   VHDGDGPKNFHVVLIDNGRTGILADEEARQTLQCIRCGACLNACPVYRQTGGHAYGSTY
FT                   GGPIGAILTPQLQNMEHAQSLPYASSLCGACYEVCPVKINIPEVLIHLRGRVVREQQSA
FT                   LKPETLGMKAVAAVFRSHRRLEAAQRLAQMAQAPLVKDGWIHRLPGELSAWTAARDLQA
FT                   IPKQSFRQWWKETHRDAE"
FT                   /protein_id="YP_002753155.1"
     atgacgattc gtgtgggcga ttcggccgag gctccttcct ttcagaaagc ggcgctgccg        60
     ctgctcaaag acgtgcagtt gcggaagaac gtaaggcatg cgaccgaggt gattcagcac       120
     aagcgcgaca tggttgccgg cgagttgccg gactggcagg ctttgcgcga ggcagcggcg       180
     gcgatcaagc ggaagacgtt gcggcatctg gatgagtatc tggagcagtt tgaggcggcc       240
     tgcctcgccg caggaggcca tgtgcactgg gctcgcgatg cggaagaagc caatcgcatt       300
     gtgctggagc tggtgcggca gcagaatgct caggaagtgc tgaagatcaa gacgatgacg       360
     gcggatgaaa ccgggctgaa ccgcgcgctg gagcaggccg gcattcatcc gcatgagacc       420
     gacctcgccg agttgattgt gcaattaggc gaggaccggc catcgcacat cgtggttccg       480
     gcgctgcaca agaatcgcaa ccaggtgcgc gagattttcc gggacaagat gcagcggcct       540
     gatctgggcg cgagtccgca ggatttgacg gaggcggcgc ggcagtatct gcgcgagaag       600
     tttctgcggg taaagacggc tattggcggc gcgaactttc tgattgccga gacgggcggc       660
     gtctgcatcg tggaatcaga aggcaatggg cgcatgtgcc tgactctgcc ggagacgctg       720
     attctgatgg tgggcgtgga aaaggtgatt ccccgctttc aggatctcga ggtctttctg       780
     caactgctgc cgcgctcggc cacgggcgag cggatgaacc cgtacaactc gatctggacg       840
     ggcgtgcatg acggagacgg tcccaagaac tttcacgtgg tgctgatcga caatgggcgc       900
     acggggattc tggcggatga ggaagcgcgg cagacgctgc agtgcattcg atgcggcgcg       960
     tgcttgaatg catgcccggt ctaccggcag acgggcggac atgcttatgg gtccacctat      1020
     ggcgggccga ttggcgcgat cctgacgccg cagcttcaga acatggagca cgcgcagtcg      1080
     ctgccctacg cctcatcgct gtgtggcgcg tgctatgaag tgtgccccgt gaagatcaat      1140
     atcccggagg tgctgataca cctgcgcggc cgggtggtgc gggagcagca gagcgcgctg      1200
     aagccggaaa cgctgggcat gaaggccgtg gccgctgtgt ttcgcagcca ccgaagactg      1260
     gaggcggcgc agcggctggc gcagatggcg caggctccgc tggtgaagga tggctggatt      1320
     caccggctgc cgggggagct gtcggcatgg acggcggcgc gcgatctaca agcgattccg      1380
     aagcagtcgt ttcggcagtg gtggaaggag acgcatcgtg acgcagagtg a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page